Recombinant Human Putative selection and upkeep of intraepithelial T-cells protein 1 homolog (SKINT1)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

SKINT1 facilitates:

  • Thymic Selection: Guides the maturation of Vγ5Vδ1 DETC progenitors in the fetal thymus . Mice lacking functional Skint1 fail to produce mature DETCs due to defective thymic selection .

  • Steady-State Epidermal Interactions: Maintains TCR-mediated contacts between DETCs and keratinocytes (KCs). Antibody blockade of SKINT1 reduces TCR-actin foci and alters DETC localization .

  • Ultraviolet (UV) Stress Response: Licenses DETCs to activate effector functions (e.g., granzyme expression) after UV-induced skin damage .

Key Experimental Findings:

  • Skint1 Antibody Treatment: Reduces Ptpn6 (SHP-1 phosphatase) expression in DETCs, impairing their activation state .

  • UV Responsiveness: SKINT1-deficient DETCs show diminished Gzmb, Gzmf, and Cxcl2 upregulation post-UVR, critical for tissue repair .

Therapeutic Potential

  • Autoimmune Disorders: Modulating SKINT1 interactions may regulate DETC-driven inflammation.

  • Cancer Immunotherapy: Targeting SKINT1-KC interactions could enhance immune surveillance in the skin.

Evolutionary Insights

SKINT1 is functional in rodents and Old World monkeys (OWMs) but inactivated in hominoids (humans, apes) due to a premature stop codon in the IgV domain .

SpeciesSKINT1 StatusFunctional Impact
Mouse/RatFunctionalCritical for DETC selection
Cynomolgus MacaqueFunctionalThymic/skin expression
Human/ChimpanzeeInactivatedLoss of Vγ5Vδ1 DETCs

Comparative Analysis with Paralogs

SKINT1 belongs to a family of 11 Skint genes in mice, but it is uniquely essential for DETC development . Other paralogs (e.g., Skint3, Skint9) regulate DETC activation in the epidermis rather than thymic selection .

Experimental Tools and Limitations

  • Recombinant Protein: Available from suppliers (e.g., MyBioSource) for in vitro studies .

  • Antibodies: Monoclonal antibodies targeting the IgV domain (e.g., 2G2) disrupt SKINT1-KC interactions .

  • Challenges:

    • Human SKINT1L Inactivation: Limited relevance of rodent models to human DETC biology .

    • Structural Complexity: Three TMDs hinder crystallization for high-resolution studies .

Future Directions

  1. Structural Elucidation: Solving the crystal structure of SKINT1’s IgV domain to identify binding partners.

  2. Therapeutic Targeting: Developing inhibitors or agonists to modulate DETC responses in autoimmune or infectious contexts.

  3. Hominoid Evolution: Investigating compensatory mechanisms for DETC loss in humans.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Target Names
SKINT1
Target Protein Sequence
MEIRWFQSHYTRPVYLYKDGKDLYGETISKYVERTELLKEAIGEGKVTLRILNVSADDDG QYHCFFKDRNVYEESITEVKVTATSLEIQILIHPPNSKGLLVECNSEGWLPQPQMEWRES RGEIIPPASKSHSQDRNRLFTMKMSLLLRDSSHGNITCYLQNPVTGQEERTSIVLPDKLF PWNSIWILILVAILAVLLFFIMLPSVELQQREQRNWCD
Uniprot No.

Q&A

What is SKINT1 and what is its primary function?

SKINT1 is a recently identified member of the immunoglobulin (Ig) supergene family that is primarily expressed by thymic epithelial cells and keratinocytes. Its main function is to specify the murine epidermal intraepithelial lymphocyte (IEL) repertoire . SKINT1 plays a critical role in the selection and development of dendritic epidermal T cells (DETCs), which are a specialized subset of γδ T cells found in the skin epidermis. The functionality of SKINT1 appears to be dependent on its surface expression and specific structural features, particularly within its membrane-distal immunoglobulin variable domain (Skint-1 DV) .

Structurally, SKINT1 contains immunoglobulin-like domains that are crucial for its function. Studies have shown that mice with dysfunctional SKINT1 display an atypical TCR repertoire in their epidermal γδ IELs, highlighting the protein's importance in immune cell development .

How is SKINT1 related to other gene families?

SKINT1 shares significant homology with several gene families:

  • Butyrophilin-like (Btnl) gene family: Among the genes most homologous to SKINT1 are the murine butyrophilin-like genes, particularly Btnl1, Btnl4, and Btnl6 . The similarity between SKINT1 and these Btnl genes is concentrated in the predicted Ig (V and C) ectodomains.

  • B7-family of costimulators: SKINT1 shares homology with the B7-family, though to a lesser extent than with Btnl genes .

  • Other SKINT family members: SKINT1 shows high homology with other SKINT family members, particularly SKINT2, with which it shares sequence homology across its entire length .

The relationship between these gene families is summarized in the table below:

GeneSimilarity to SKINT1Location of SimilarityFunctional Relevance
Btnl1, Btnl4, Btnl6HighPrimarily in Ig ectodomainsPotential regulators of gut inflammation
SKINT2HighAcross entire lengthPotential functional redundancy
Btn1a1ModeratePrimarily in Ig domainsUnknown
Btnl2LowLimited regionsLess likely to share functional mechanisms
B7-familyLowestLimited regionsDistant evolutionary relationship

What methodologies are commonly used to study SKINT1 expression?

Several methodologies have been established for studying SKINT1 expression and function:

  • RACE-analysis and cloning: This technique has been used to redefine intron-exon boundaries of SKINT1-related genes and identify splice variants .

  • Quantitative tissue expression analysis: Studies have examined tissue-specific expression patterns of SKINT1, showing its predominance in thymic epithelial cells and keratinocytes .

  • Reaggregate Thymic Organ Culture (RTOC): This technique has been crucial for functional studies of SKINT1. It involves preparing single-cell suspensions from fetal thymi, spin-infection with retroviruses containing SKINT1 constructs, and subsequent reaggregation to study SKINT1's role in T-cell selection .

  • Recombinant protein expression systems: E. coli-based expression systems have been used to produce recombinant SKINT1 for structural and functional studies .

  • Mutagenesis approaches: Site-directed mutagenesis has been employed to create SKINT1 variants with specific amino acid substitutions, particularly in the CDR3-like loop region .

How does the structure of SKINT1 relate to its function?

The structure of SKINT1, particularly its membrane-distal immunoglobulin variable domain (Skint-1 DV), is critical for its function in DETC selection. Nuclear magnetic resonance spectroscopy has revealed that Skint-1 DV adopts a compact β-sandwich domain comprising two anti-parallel sheets :

  • Front sheet consisting of strands A', B, D, E

  • Back sheet encompassing strands C, C', F, G

Key structural features that relate to function include:

  • CDR3-like loop region: Contains specific residues (particularly Asp127 and Asp129) that are essential for DETC selection . Mutations in these residues abolish SKINT1's ability to support DETC development.

  • Surface exposure: The CDR3-like loop sits within an exposed surface of the membrane-distal region, suggesting it may directly participate in receptor-ligand interactions .

  • Structural homology: SKINT1 DV shows structural similarities to other immunologically important proteins, including BTN3A1, which plays a key role in phosphoantigen-mediated activation of human peripheral blood γδ T cells .

These structural features indicate that SKINT1-mediated T-cell selection likely results from direct cell surface receptor-ligand interactions, with the specific structural elements of the DV domain being crucial for recognition by relevant receptors.

What are the critical residues in SKINT1 that mediate its selection function, and how were they identified?

The critical residues in SKINT1 that mediate its selection function are primarily located in the CDR3-like loop of the membrane-distal immunoglobulin variable domain (Skint-1 DV). Through detailed mutagenesis and functional studies, researchers have identified specific amino acids that are essential for SKINT1's ability to support DETC development .

Key residues identified:

  • Asp127: Mutation of this residue to alanine abolishes SKINT1's ability to rescue DETC selection in thymic organ culture experiments .

  • Asp129: Similar to Asp127, alanine substitution at this position prevents SKINT1-mediated DETC selection .

Experimental approaches used to identify these residues:

  • Site-directed mutagenesis: Researchers created various SKINT1 constructs with specific mutations in the CDR3-like loop region, including:

    • Individual alanine substitutions of Asp127 and Asp129

    • Chimeric constructs where the CDR3 loop sequence of SKINT1 was substituted with that of SKINT2 (incorporating D127V and D129E mutations)

  • Reaggregate Thymic Organ Culture (RTOC) assays: These functional assays demonstrated that SKINT1 constructs featuring alanine mutations of Asp127 and Asp129 failed to rescue DETC selection, confirming their critical importance .

  • Surface plasmon resonance: This technique was used to compare the binding of anti-SKINT1 monoclonal antibodies to wild-type and mutant SKINT1 proteins, helping to distinguish between mutations that affect antibody binding versus those that affect DETC selection .

  • Structural studies: Nuclear magnetic resonance spectroscopy was used to determine the three-dimensional structure of Skint-1 DV, revealing that these critical residues are located in an exposed surface region that likely participates in receptor-ligand interactions .

These findings suggest that the CDR3-like loop region of SKINT1, particularly residues Asp127 and Asp129, forms a putative receptor binding surface that is essential for SKINT1's function in selecting and maintaining the proper development of DETCs.

How do SKINT1 and Btnl proteins compare in their tissue-specific regulation of T cells?

SKINT1 and Btnl proteins show intriguing similarities and differences in their tissue-specific regulation of T cells, suggesting specialized roles in local immune regulation :

Similarities:

  • Structural homology: Both SKINT1 and certain Btnl proteins (particularly Btnl1, Btnl4, and Btnl6) share significant structural similarities, especially in their Ig-like domains .

  • Epithelial expression: Both are predominantly expressed in epithelial tissues that are rich in resident T cells .

  • Local immune regulation: Both appear to regulate intraepithelial lymphocyte (IEL) populations in their respective tissues .

  • Receptor-ligand interactions: Both are believed to function through direct cell surface interactions with receptors on T cells .

Key differences in tissue distribution and function:

ProteinPrimary Tissue ExpressionT Cell Population RegulatedFunctional Mechanism
SKINT1Thymic epithelium, epidermisEpidermal γδ IELs (DETCs)Specifies TCR repertoire during development
Btnl1Small intestinal epitheliumIntestinal IELsAttenuates epithelial cell responses to activated IELs
Btnl4, Btnl6Small intestinal epitheliumIntestinal IELsNot fully characterized

Functional differences:

  • SKINT1: Primarily involved in the developmental selection of epidermal γδ IELs, with mutations resulting in an atypical TCR repertoire .

  • Btnl1: Functions as an immune modulator in the intestine, where its expression can attenuate the epithelial cell response to activated IELs, suppressing IL-6 and other inflammatory mediators .

Interestingly, there appears to be a correlation between Btnl1 expression levels and the composition of intestinal IEL populations. Mouse strains with lower levels of Btnl1 RNA typically have larger numbers of Vδ4+ IELs . This parallels SKINT1's role in determining the TCR repertoire of epidermal IELs, suggesting similar but tissue-specific mechanisms of action.

The tissue-specific expression patterns and functions of these proteins highlight their potential roles as local regulators of epithelial-T cell interactions, with SKINT1 specializing in skin immunity and Btnl proteins focusing on intestinal immune homeostasis.

What techniques are used to determine the solution structure of SKINT1 DV, and what insights does the structure provide?

The solution structure of SKINT1 DV was determined using nuclear magnetic resonance (NMR) spectroscopy, employing a comprehensive suite of techniques to achieve high-resolution structural data :

NMR techniques employed:

  • Sample preparation: Recombinant SKINT1 DV (residues Ser24 to Thr141) was expressed in E. coli using M9 minimal media supplemented with [15N]ammonium chloride and [13C]glucose for isotopic labeling .

  • Data acquisition: NMR experiments were performed at 303K on Varian Inova 600 and 800 MHz NMR spectrometers equipped with triple resonance cryogenic probes .

  • Backbone and side chain assignments: Made using multiple NMR experiments including:

    • BEST versions of 15N-HSQC

    • CBCA(CO)NH, HNCACB

    • HNCA, HN(CO)CA

    • HNCO, HN(CA)CO

    • H(C)CH TOCSY, (H)CCH TOCSY

    • 15N-edited NOESY-HSQC (mixing time = 100 ms)

    • 13C-edited NOESY-HSQC (mixing time = 100 ms)

  • Data processing and analysis: Spectra were processed using NMRPipe and analyzed using SPARKY .

Structural features and quality metrics:

The solution structure of SKINT1 DV yielded an ensemble of 20 structures with the following metrics:

Structural ParameterValue
Mean backbone RMSD (structured regions)0.8 Å
Resonance assignments completion (backbone)88.22%
Resonance assignments completion (side chain)79.29%
Total NOE distance restraints828
Dihedral angle restraints180
Hydrogen bond restraints50
Restraints per residue9.4

Structural insights:

These structural insights have been instrumental in understanding how SKINT1 mediates its selective function in T-cell development and provide a foundation for further studies on receptor-ligand interactions involving this protein.

How can researchers effectively design mutations in SKINT1 to study structure-function relationships?

Based on the available structural and functional data, researchers can employ several strategic approaches to design mutations in SKINT1 that effectively probe structure-function relationships:

Methodological approaches:

  • Structure-guided mutagenesis: Using the solved NMR structure of SKINT1 DV as a guide, researchers can target:

    • The CDR3-like loop region (already shown to be functionally critical)

    • Other exposed surfaces that may participate in molecular interactions

    • Residues that maintain the structural integrity of the protein

  • Chimeric protein construction: Creating chimeras between SKINT1 and related proteins (e.g., SKINT2, Btnl1) can help identify which regions confer specificity. Successful examples include:

    • CDR3 loop chimeras between SKINT1 and SKINT2 (D127V and D129E mutations)

    • Domain-swapping experiments between SKINT1 and other Ig-domain containing proteins

  • Alanine-scanning mutagenesis: Systematic replacement of surface residues with alanine to identify critical interaction points. The successful identification of Asp127 and Asp129 as key residues employed this approach .

  • Conservation-based targeting: Focusing on residues conserved between species but divergent between family members can help identify functionally important sites.

Experimental validation approaches:

  • Reaggregate Thymic Organ Culture (RTOC): This system has proven effective for functional validation, allowing:

    • Assessment of DETC selection rescue by mutant SKINT1 constructs

    • Quantitative measurement of effects on different T-cell populations

  • Surface expression analysis: Ensuring mutants are properly expressed at the cell surface is crucial, as DETC selection depends on cell-surface expression of SKINT1 .

  • Binding assays: Surface plasmon resonance and other binding assays can determine if mutations affect:

    • Antibody recognition

    • Putative receptor interactions

  • Structural validation: For mutations predicted to affect protein folding, additional NMR studies can confirm structural integrity.

Suggested mutation design protocol:

  • Generate a comprehensive list of candidate residues based on:

    • Structural exposure (solvent-accessible surface area)

    • Charge and hydrophobicity (for potential interaction sites)

    • Conservation analysis

    • Proximity to known functional regions (e.g., CDR3-like loop)

  • Prioritize mutations based on:

    • Single amino acid substitutions first (to minimize structural disruption)

    • Conservative substitutions to test specific interactions

    • Non-conservative substitutions to test charge or hydrophobicity requirements

  • Include appropriate controls:

    • Known functional mutants (e.g., D127A, D129A) as negative controls

    • Wild-type SKINT1 as positive control

    • Structure-disrupting mutations to distinguish between specific functional effects and general structural requirements

Following these approaches will enable researchers to systematically probe the structure-function relationships of SKINT1 and gain deeper insights into its molecular mechanisms of action in T-cell selection and maintenance.

What is the evolutionary relationship between human and mouse SKINT1, and what are the implications for translational research?

The evolutionary relationship between human and mouse SKINT1 presents both challenges and opportunities for translational research, revealing important species-specific differences:

Evolutionary status:

In humans, SKINT1 exists as SKINT1L (SKINT1-Like), which is classified as a pseudogene . This is in stark contrast to mice, where SKINT1 is a functional gene critical for epidermal γδ T-cell development .

Human SKINT1L characteristics:

  • Gene ID: 391037

  • Location: Chromosome 1

  • Previous names: SKINTP, SKINTL

  • Status: Non-functional pseudogene

Implications for translational research:

  • Functional compensation: Given the importance of SKINT1 in mice, the pseudogenization in humans suggests either:

    • Another protein has assumed SKINT1's function in humans

    • The specific γδ T-cell population regulated by SKINT1 in mice has different developmental requirements or is absent in humans

  • Comparative immunology insights: The functional differences provide an opportunity to understand:

    • Divergent evolution of tissue-resident T-cell populations between species

    • Alternative mechanisms for selecting and maintaining human IELs

    • The relative importance of different IEL subsets in tissue immunity

  • Therapeutic considerations:

    • Direct SKINT1 mimics would likely have different effects in humans versus mice

    • Understanding the molecular mechanisms of SKINT1 function in mice may still inform human immunomodulatory strategies, particularly if functional analogs exist

  • Research approach adaptations:

    • Human studies should focus on identifying functional analogs rather than direct SKINT1 homologs

    • Btnl family members may be more promising translational targets, as many have functional human homologs

    • The BTN3A1 protein, which shows structural similarity to SKINT1 and regulates human γδ T cells, may provide a better translational model

  • Experimental design considerations:

    • Mouse models for SKINT1 function will have limited direct translational value

    • Humanized mouse models may require co-introduction of putative human functional analogs

    • Comparative studies of BTN/BTNL family members across species may be more informative

This evolutionary divergence highlights the importance of careful cross-species comparisons in immunological research. While direct translation of murine SKINT1 findings to humans is limited by pseudogenization, the underlying principles of epithelial cell-mediated selection and regulation of tissue-resident T cells are likely conserved, albeit through different molecular mediators.

What are the optimal conditions for expressing and purifying recombinant SKINT1 protein?

Based on the available research, the following protocol represents optimized conditions for expressing and purifying recombinant SKINT1 protein, particularly focusing on the SKINT1 DV domain:

Expression system selection:

E. coli has been successfully employed for SKINT1 DV expression, particularly the BL21(DE3) strain . For expression of full-length SKINT1 (including transmembrane domains), mammalian expression systems would be preferable.

Construct design considerations:

  • Domain selection: For structural and binding studies, the membrane-distal immunoglobulin variable domain (Skint-1 DV, residues Ser24 to Thr141) is commonly used .

  • Tags and fusion partners:

    • C-terminal biotinylation tags for surface plasmon resonance studies

    • N-terminal His-tags for affinity purification

    • Potential fusion partners (e.g., MBP, GST) for enhancing solubility

Expression protocol for SKINT1 DV:

  • Vector selection: pET23a expression vector has been successfully used

  • Media and growth conditions:

    • For unlabeled protein: Standard LB media

    • For NMR studies: M9 minimal media supplemented with [15N]ammonium chloride and [13C]glucose

  • Induction conditions:

    • IPTG concentration: 0.5-1 mM

    • Temperature: 18-25°C for soluble expression

    • Duration: 16-18 hours

Purification strategy:

  • Cell lysis: Sonication or French press in buffer containing protease inhibitors

  • Inclusion body processing (if protein is insoluble):

    • Washing with detergent-containing buffers

    • Solubilization with 8M urea or 6M guanidine hydrochloride

  • Refolding procedure:

    • Dilution method using 50mM Tris-HCl pH 8.5, 0.4M L-arginine, 0.5mM EDTA buffer

    • Dialysis against stepwise reducing concentrations of denaturants

  • Chromatography steps:

    • Initial capture: Immobilized metal affinity chromatography (IMAC)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Protein concentration: Centricon Plus-70 centrifugal filters or equivalent

Quality control assessments:

  • Purity analysis: SDS-PAGE, Western blotting, mass spectrometry

  • Structural integrity: Circular dichroism, thermal shift assays

  • Functional validation: Antibody binding assays (e.g., using Skint-1 mAb)

  • Storage conditions: Typically in PBS or similar buffer at -80°C for long-term storage

Troubleshooting common issues:

  • Low solubility: Consider lower induction temperatures, co-expression with chaperones, or fusion to solubility-enhancing tags

  • Improper folding: Optimize refolding conditions by testing different buffer compositions, additives, and refolding methods

  • Low yield: Optimize codon usage for E. coli, consider alternative expression systems

  • Protein aggregation: Add stabilizers (e.g., glycerol, arginine) to storage buffer, avoid freeze-thaw cycles

This protocol provides a starting point for researchers seeking to express and purify SKINT1 for functional and structural studies, with adaptations required based on the specific experimental goals and protein constructs.

How can researchers effectively set up Reaggregate Thymic Organ Culture (RTOC) experiments to study SKINT1 function?

Reaggregate Thymic Organ Culture (RTOC) has proven to be an invaluable technique for studying SKINT1 function, particularly its role in T-cell selection. The following protocol outlines the key steps and considerations for setting up effective RTOC experiments:

Equipment and reagents required:

  • Collagenase-dispase

  • Retroviral vectors (MSCV-derived bicistronic vectors)

  • LinXE packaging cells

  • Millipore filtration system

  • Antibodies for flow cytometry

  • FACS LSRII or equivalent flow cytometer

  • Cell culture incubator (37°C, 10% CO2)

  • Complete cell culture media

Detailed RTOC protocol:

  • Fetal thymus preparation:

    • Harvest E14-E15 fetal thymi (timing is critical for proper developmental stage)

    • Prepare single-cell suspensions by digestion with collagenase-dispase according to established protocols

    • Ensure thorough digestion while maintaining cell viability (typically >90%)

  • Retroviral vector preparation:

    • Clone SKINT1 constructs (wild-type or mutants) into MSCV-derived bicistronic vectors

    • Transfect LinXE cells with these constructs to produce retrovirus

    • Harvest and concentrate retrovirus to 20× using appropriate methods

    • Titer virus to ensure consistent infection rates between experiments

  • Thymic cell infection:

    • Spin-infect thymic cell suspensions with concentrated retrovirus for 45 minutes

    • Optimal cell density: 1-2 × 10^6 cells per infection

    • Include appropriate controls:

      • Empty vector control

      • Wild-type SKINT1 positive control

      • Known non-functional SKINT1 mutant (e.g., D127A) as negative control

  • Reaggregation procedure:

    • Pellet four thymic lobe equivalents of infected cells

    • Filter the cell slurry using Millipore filters

    • Plate onto culture inserts or similar support structures

    • Incubate at 37°C with 10% CO2

    • Culture duration: 5-7 days (optimize based on developmental questions being addressed)

  • Analysis of RTOC:

    • Disaggregate cultures using collagenase-dispase

    • Stain with relevant antibodies for T-cell subset identification:

      • γδ TCR, CD3 (T cells)

      • Vγ5 (DETC precursors)

      • CD45RB, CD24, CD62L (maturation markers)

    • Analyze by flow cytometry using FACS LSRII and FlowJo software

    • Quantify percentages and absolute numbers of relevant cell populations

Experimental design considerations:

  • Controls:

    • Include both positive (wild-type SKINT1) and negative (empty vector) controls in each experiment

    • When testing mutants, include a known non-functional mutant as benchmark

  • Readouts:

    • Primary: Development of Vγ5+ DETC precursors

    • Secondary: Maturation markers on developing T cells

    • Consider measuring cell proliferation and apoptosis rates

  • Validation approaches:

    • Confirm expression of SKINT1 constructs using flow cytometry or western blotting

    • Include surface expression controls to distinguish between expression and functional defects

    • Consider parallel in vivo validation for key findings

  • Statistical analysis:

    • Perform at least three independent experiments for statistical significance

    • Use appropriate statistical tests (typically ANOVA with post-hoc tests)

    • Present data with clear indication of variability (standard deviation or standard error)

Troubleshooting common issues:

ProblemPotential CauseSolution
Poor cell viabilityExcessive digestion, improper handlingOptimize digestion time, maintain cells on ice when possible
Low infection efficiencyPoor virus quality, insufficient spin-infectionFreshly prepare virus, optimize spin parameters
Poor reaggregationInsufficient cell numbers, improper filtrationEnsure adequate cell numbers, optimize filtration step
High variability between replicatesInconsistent fetal thymus age, variable infectionCarefully stage embryos, standardize all procedures
No phenotype with known functional constructsTechnical issues with culture conditionsVerify gas mixture, media composition, culture duration

Following this protocol will enable researchers to effectively use RTOC to investigate SKINT1 function, particularly its role in T-cell selection and development.

What approaches can be used to identify potential binding partners for SKINT1?

Identifying binding partners for SKINT1 is critical for understanding its molecular mechanism of action. Multiple complementary approaches can be employed to systematically search for SKINT1 interactors:

Biochemical and protein-protein interaction approaches:

  • Immunoprecipitation and co-immunoprecipitation:

    • Express tagged SKINT1 in relevant cell types (e.g., thymic epithelial cells)

    • Immunoprecipitate using tag-specific antibodies or SKINT1-specific antibodies

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions using reverse co-immunoprecipitation

  • Proximity labeling techniques:

    • BioID: Fuse SKINT1 to a biotin ligase (BirA*) to biotinylate proximal proteins

    • APEX2: Fuse SKINT1 to engineered ascorbate peroxidase for proximity labeling

    • These methods are particularly useful for membrane proteins like SKINT1 and can capture transient interactions

  • Cross-linking mass spectrometry:

    • Apply membrane-permeable crosslinkers to stabilize protein-protein interactions

    • Enrichment of SKINT1 complexes followed by mass spectrometry

    • Identification of crosslinked peptides to define interaction interfaces

  • Protein microarrays:

    • Screen purified SKINT1 against arrays of potential interactors (e.g., immune receptor libraries)

    • Particularly useful for identifying interactions with soluble proteins or ectodomains

Biophysical interaction approaches:

  • Surface plasmon resonance (SPR):

    • Immobilize biotinylated SKINT1 on sensor chips

    • Screen candidate interactors for binding

    • Determine binding kinetics and affinity for validated interactions

  • Biolayer interferometry (BLI):

    • Similar to SPR but with different detection principles

    • Useful for screening multiple potential interactors in parallel

  • Microscale thermophoresis (MST):

    • Label SKINT1 with fluorescent dye

    • Measure changes in thermophoretic mobility upon binding to partners

    • Requires less protein than SPR/BLI and works in solution

  • Isothermal titration calorimetry (ITC):

    • Label-free measurement of binding thermodynamics

    • Provides complete thermodynamic profile of interactions

    • Requires larger amounts of purified proteins

Cellular and functional approaches:

  • Cell adhesion assays:

    • Express SKINT1 in one cell population and potential receptors in another

    • Measure cell-cell adhesion as indicator of interaction

    • Particularly relevant given SKINT1's role in cell-cell communication

  • Reporter cell assays:

    • Generate cell lines expressing SKINT1 and reporter constructs for relevant signaling pathways

    • Co-culture with cells expressing candidate receptors

    • Monitor activation of signaling pathways (e.g., NFAT, NF-κB)

  • CRISPR screens:

    • Perform genome-wide CRISPR screens in systems where SKINT1 function can be measured

    • Identify genes whose knockout affects SKINT1-dependent phenotypes

    • Follow up on candidates as potential binding partners or downstream effectors

Computational and structural approaches:

  • Structure-based prediction:

    • Use the solved structure of SKINT1 DV to predict potential interaction interfaces

    • Molecular docking with candidate receptors

    • Focus on the CDR3-like loop region that has been functionally implicated

  • Evolutionary analysis:

    • Identify co-evolving protein families that may interact with SKINT1

    • Compare across species to identify conserved potential interactions

  • Network analysis:

    • Analyze protein-protein interaction databases for proteins that interact with SKINT1-related molecules

    • Build interaction networks to identify high-probability candidates

Validation and characterization strategies:

  • Mutagenesis of interaction interfaces:

    • Design mutations in the predicted binding surfaces (e.g., CDR3-like loop)

    • Test effects on:

      • Physical interaction (by methods above)

      • Functional outcomes (RTOC assays)

  • Structural studies of complexes:

    • X-ray crystallography or cryo-EM of SKINT1 bound to identified partners

    • NMR studies of labeled SKINT1 with binding partners to identify interaction surfaces

  • In vivo validation:

    • Generate mouse models with mutations affecting specific interactions

    • Assess phenotypes relative to SKINT1-deficient mice

A systematic combination of these approaches will maximize the chances of identifying physiologically relevant binding partners for SKINT1, providing critical insights into its mechanism of action in T-cell selection and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.