Recombinant Human Putative tetraspanin-19 (TSPAN19)

Shipped with Ice Packs
In Stock

Description

Introduction

Tetraspanins (TSPANs) are a family of highly conserved proteins found in eukaryotes . These proteins, characterized by four transmembrane segments, participate in various cellular processes, including cancer development, immune responses, fertility, and infectious diseases . TSPANs can influence tumor growth via angiogenesis, immunological function, platelet coagulation, and infection . TSPAN19, a member of the TSPAN family, is found in humans .

General Information

TSPAN19, also known as tetraspanin 19, is encoded by the TSPAN19 gene in humans . Tetraspanins, including TSPAN19, have a small extracellular structural domain and a large extracellular loop (LEL) . Intracellular domains are small and feature palmitoylated cysteines, along with N- and C-terminal tails . Sequence homology among TSPAN isoforms is highly conserved, except for a small variable region within the LEL .

TSPAN19 in Cancer

TSPANs can regulate cancer cell growth, metastasis, stemness, and drug resistance, as well as the biogenesis of extracellular vesicles like exosomes and migrasomes .

TSPAN19 and Genome-Wide Association Studies

Genome-wide association studies have identified TSPAN19 as a candidate gene in various genetic analyses . For example, TSPAN19 is among 16 genes located in a region on GGA1 (chicken chromosome 1) spanning 1.27 Mb, which contains 768 SNPs and 87 INDELs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
TSPAN19; Tetraspanin-19; Tspan-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TSPAN19
Target Protein Sequence
MLRNNKTIIIKYFLNLINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQIL IGMGSSTVLFCLLGYIGIHNEIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHD KIDFVISEYGSKDKPEDITKWTILNALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTK STLRKWFCDEPLNATYLEGCENKISAWYNVNVLTLIGINFGLLTSEVFQVSLTVCFFKNI KNIIHAEM
Uniprot No.

Target Background

Database Links

HGNC: 31886

KEGG: hsa:144448

STRING: 9606.ENSP00000433816

UniGene: Hs.156962

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural characterization of TSPAN19 compared to other tetraspanins?

    TSPAN19 contains the hallmark structural elements of the tetraspanin family: four transmembrane domains, a small extracellular loop (SEL), a large extracellular loop (LEL) containing conserved cysteine motifs (CCG, PXSC, and EGC), and short cytoplasmic N- and C-terminal regions .

    Methodological approach:

    • Sequence alignment tools reveal that TSPAN19, like other tetraspanins, contains disulfide linkages formed by conserved cysteine residues essential for maintaining subloop structure within the LEL domain

    • Homology modeling using solved tetraspanin structures (such as CD81) can predict structural features

    • Circular dichroism spectroscopy can be employed to assess secondary structure content

    • For full structural determination, consider X-ray crystallography of recombinant TSPAN19 domains or cryo-EM for full-length protein

  • What expression patterns does TSPAN19 exhibit across human tissues and how can these be accurately determined?

    Current data suggests TSPAN19 has a more restricted expression pattern compared to ubiquitous tetraspanins like CD9, CD81, and CD63 . The STRING database indicates potential interactions with other tetraspanins including TSPAN2, TSPAN32, and TSPAN16 .

    Methodological approach:

    • RNA-seq analysis across tissue panels (similar to analyses done for TSPAN15 in cancer tissues )

    • qRT-PCR validation in primary tissues and cell lines

    • Immunohistochemistry with validated antibodies (consider using TSPAN19-knockout tissues as controls)

    • Single-cell sequencing to identify cell-specific expression within tissues

    • Western blot analysis for protein-level confirmation (note that RNA levels may not always correlate with protein expression, as observed with CD63 )

  • What strategies should be employed for optimizing recombinant TSPAN19 expression?

    Expressing functional tetraspanins presents challenges due to their transmembrane nature and complex folding requirements.

    Methodological approach:

    • Expression system selection: While bacterial systems offer high yield, mammalian cells (HEK293T) provide proper folding and post-translational modifications critical for tetraspanin function

    • For the EC2 domain alone, GST-fusion proteins have been successfully used with other tetraspanins

    • Consider codon optimization for the expression system

    • Purification approach: Detergent selection is critical (n-Dodecyl-β-D-maltoside with cholesteryl hemisuccinate has worked for other tetraspanins)

    • Validation by Western blot, mass spectrometry, and circular dichroism to confirm proper folding

Advanced Research Questions

  • How can researchers effectively identify and characterize TSPAN19 binding partners?

    Understanding protein-protein interactions is essential for elucidating TSPAN19 function within tetraspanin-enriched microdomains (TEMs).

    Methodological approach:

    • Co-immunoprecipitation using mild detergents (CHAPS, Brij96/97) to preserve tetraspanin interactions

    • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to TSPAN19

    • FRET/BRET assays for direct interaction assessment

    • Crosslinking mass spectrometry to capture transient interactions

    • Validation with reciprocal pull-downs and mutagenesis of key residues

    • Consider the CD19-CD81 interaction model as a template, where the binding interface has been well-characterized

    Predicted TSPAN19 Interaction PartnersInteraction Score
    C7orf770.582
    TSPAN20.539
    LRRIQ10.532
    FAM216B0.518
    TSPAN320.503
    CD810.424

    Table derived from STRING database analysis

  • What roles might TSPAN19 play in cancer biology and how can these be investigated?

    Multiple tetraspanins have been implicated in cancer progression, acting as either tumor promoters or suppressors depending on context and cancer type .

    Methodological approach:

    • Expression correlation analysis using cancer genomics databases (TCGA, ICGC)

    • CRISPR/Cas9 knockout or siRNA knockdown followed by oncogenic phenotype assessment

    • Overexpression studies in relevant cell lines

    • Focus on key cancer hallmarks: proliferation, migration, invasion, drug resistance

    • Consider examining TSPAN19 in relation to pathways affected by other tetraspanins:

      • PI3K/Akt/GSK-3β (implicated in TSPAN1-mediated effects)

      • MAPK pathway (affected by TSPAN9 in gastric cancer)

      • Wnt/β-catenin signaling (modulated by TSPAN8 in chemoresistance)

    • Examine correlation with clinical parameters and patient outcomes

  • How can the function of TSPAN19 in extracellular vesicle (EV) biology be investigated?

    Tetraspanins are enriched in EVs and play roles in their biogenesis, cargo selection, and targeting .

    Methodological approach:

    • EV isolation by differential ultracentrifugation, size exclusion chromatography, or density gradient

    • Characterization by nanoparticle tracking analysis, Western blotting, and electron microscopy

    • Comparative proteomic analysis of EVs from wild-type versus TSPAN19-depleted cells

    • Examine TSPAN19's role in EV biogenesis using live-cell imaging with fluorescently tagged proteins

    • Investigate how TSPAN19 may influence EV uptake by recipient cells

    • Consider studying TSPAN19 in relation to established EV tetraspanins (CD9, CD63, CD81)

    • Assess TSPAN19's potential role in EV cargo selection similar to other tetraspanins that determine ~45% of exosomal proteome

  • What approaches should be used to study TSPAN19's potential involvement in viral infection processes?

    Several tetraspanins function as cofactors for viral entry, assembly, and egress .

    Methodological approach:

    • Viral infection studies in cells with TSPAN19 knockdown/overexpression

    • Production of recombinant TSPAN19 EC2 domains to test inhibition of viral infection (similar to CD9, CD63, CD81, and CD151 inhibition of HIV-1)

    • Co-localization studies with viral components during infection

    • Binding assays between virions and recombinant TSPAN19

    • Test multiple virus types as tetraspanin involvement can be virus-specific

    • Examine concentration-dependent effects (EC50 values for other tetraspanin EC2 domains against HIV-1 range from 0.11-1.2 nM)

    • Investigate timing-dependent effects (tetraspanin inhibition is most effective when added before or during viral inoculation)

  • How can researchers develop specific antibodies against TSPAN19 given the high conservation among tetraspanin family members?

    Generating specific antibodies against tetraspanins presents challenges due to family conservation and conformational epitopes.

    Methodological approach:

    • Target the variable regions within the LEL domain, which contains the highest sequence diversity

    • Consider using synthetic peptides from unique regions rather than whole protein immunization

    • Screen antibodies against multiple tetraspanins to ensure specificity

    • Validate using TSPAN19-knockout cells as negative controls

    • Test under both native and denatured conditions as many tetraspanin epitopes are conformational

    • Consider developing conformation-specific antibodies similar to anti-CD81 5A6 that recognizes a specific conformation

    • Employ phage display or yeast display technologies for isolating highly specific binders

  • What cellular processes might be regulated by TSPAN19 based on functions of related tetraspanins?

    Understanding established functions of other tetraspanins can guide investigation of TSPAN19.

    Methodological approach:

    • Cell adhesion assays (multiple tetraspanins modulate integrin-mediated adhesion)

    • Cell migration studies (scratch assays, transwell migration)

    • Membrane dynamics assessment (filipin staining for cholesterol, FRAP for membrane fluidity)

    • Receptor trafficking studies (surface biotinylation, internalization assays)

    • Signal transduction analysis focusing on pathways modulated by other tetraspanins:

      • FAK/Src/ERK pathway (regulated by TSPAN7 and TSPAN9)

      • PI3K/Akt (modulated by TSPAN15 in osteosarcoma)

      • Notch signaling (affected by TSPAN5 in hepatocellular carcinoma)

  • How can super-resolution microscopy be optimized to study TSPAN19 organization in tetraspanin-enriched microdomains?

    Tetraspanins form specialized membrane domains with nanoscale organization that requires advanced imaging techniques .

    Methodological approach:

    • STED (Stimulated Emission Depletion) microscopy has successfully revealed that tetraspanins form individual nanoclusters smaller than 120nm

    • Dual-color STED can examine co-localization with other tetraspanins and partner proteins

    • Sample preparation is critical; consider fixation methods that preserve membrane structure

    • Fluorophore selection should prioritize photostability and brightness

    • Controls should include other tetraspanin family members to compare clustering patterns

    • Quantitative analysis should measure cluster size, density, and molecular count per cluster (CD53 clusters contain less than ten molecules)

    • Consider using PALM/STORM for single-molecule localization microscopy as complementary approaches

  • What techniques can determine if TSPAN19 plays a role in tetraspanin-mediated chemoresistance?

    Multiple tetraspanins (TSPAN1, TSPAN8, CD9) have been implicated in promoting drug resistance in cancer .

    Methodological approach:

    • Generate stable TSPAN19 knockdown and overexpression cell lines

    • Perform drug sensitivity assays with multiple chemotherapeutic agents

    • Analyze expression of drug resistance-related proteins (CXCL12, CCL5, CCR5, BCRP)

    • Examine TSPAN19 expression in paired pre- and post-treatment clinical samples

    • Investigate pathway activation changes focusing on known resistance mechanisms:

      • Wnt/β-catenin pathway (TSPAN8-mediated resistance)

      • p38 MAPK activation (CD82-mediated resistance)

      • Hedgehog signaling (TSPAN8-mediated stem cell properties)

    • Consider combinatorial approaches targeting TSPAN19 alongside chemotherapy

  • How might TSPAN19 function in immune cell regulation and what methods should be used to investigate this role?

    Many tetraspanins play crucial roles in immune cell function, particularly in antigen presentation .

    Methodological approach:

    • Flow cytometry to assess TSPAN19 expression across immune cell subsets

    • Examine colocalization with MHC molecules and immune receptors

    • In T cells, assess impact on TCR signaling complex formation

    • In B cells, examine effects on BCR signaling similar to CD81-CD19 interaction

    • In antigen-presenting cells, investigate antigen presentation efficiency

    • Consider tetraspanin involvement in immunological synapse formation

    • Examine TSPAN19 redistribution during immune cell activation

    • Use recombinant TSPAN19 EC2 domains to potentially modulate immune cell functions

Biophysical and Biochemical Research Questions

  • What are the optimal conditions for studying TSPAN19 dynamics in cellular membranes?

    Tetraspanins exhibit specific membrane organization and dynamics that require specialized techniques to study.

    Methodological approach:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure lateral mobility

    • FCS (Fluorescence Correlation Spectroscopy) for diffusion coefficient determination

    • Use palmitoylation-deficient mutants to assess role of post-translational modifications

    • Consider cholesterol depletion experiments as tetraspanin microdomains are partially cholesterol-dependent

    • TIRF microscopy can be used to visualize membrane-proximal dynamics

    • Single-particle tracking to follow individual TSPAN19 molecules

    • Detergent solubility assays using different detergents can reveal membrane microdomain association

  • How can researchers effectively distinguish between redundant and unique functions of TSPAN19 among tetraspanin family members?

    Tetraspanins often show functional redundancy, making it challenging to identify unique functions.

    Methodological approach:

    • Generate multiple single and combinatorial knockouts using CRISPR/Cas9

    • Create chimeric proteins by swapping domains between tetraspanins to identify functional regions

    • Perform rescue experiments using other tetraspanins in TSPAN19-deficient cells

    • Conduct comprehensive interactome analysis to identify unique binding partners

    • Consider evolutionary conservation analysis to identify TSPAN19-specific features

    • Utilize tissue-specific or inducible knockout models to avoid developmental compensation

    • Employ acute protein depletion techniques (e.g., auxin-inducible degron system) to bypass compensatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.