Recombinant Human Putative transmembrane protein C8orfK29 (C8orfK29)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM249; C8orfK29; Transmembrane protein 249
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM249
Target Protein Sequence
MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYLDT LWKGMLLFIISVVLVSFSSLREVQKQETWVFLVYGVGVGLWLVISSLPRRRLVLNHTRGV YHFSIQGRTVCQGPLHLVYVRLALSSDAHGRCFFHLVLGGHRLEPLVLVQLSEHYEQMEY LGRYIARKLNINYFDYLATSYRHVVRHWPPPGAGTVMGKSPMGHKPSSSQSSLEV
Uniprot No.

Target Background

Database Links

HGNC: 44155

KEGG: hsa:340393

UniGene: Hs.122231

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the recommended protocols for expressing Recombinant Human Putative transmembrane protein C8orfK29 in cellular systems?

For optimal expression of Recombinant Human Putative transmembrane protein C8orfK29, HEK293 cell lines are recommended due to their efficiency in producing complex transmembrane proteins with appropriate post-translational modifications (PTMs) .

Protocol overview:

  • Cell line selection: HEK293 or HEK293F cells are preferred for transmembrane protein expression due to their capacity for human-like PTMs and high transfection efficiency .

  • Expression vector construction: Create an expression construct containing the C8orfK29 gene with appropriate regulatory elements. Consider including a histidine tag (as seen in commercially available constructs) for purification purposes .

  • Transfection method: Use either calcium phosphate or polyethylenimine (PEI) for transient gene expression (TGE), which has been demonstrated to be effective in stirred-tank bioreactors .

  • Stable cell line generation: For higher yields, develop stable producer cell lines rather than relying on transient expression. After transfection, select stable transfectants and identify optimal production clones .

  • Expression enhancement: Consider implementing glutamine synthetase (GS)-mediated gene amplification to improve recombinant protein production, as demonstrated with other proteins in HEK293 cells .

  • Culture conditions: Use serum-free, chemically defined cell culture media for optimal growth and protein expression .

What experimental design considerations are most important when studying C8orfK29 function?

When designing experiments to study C8orfK29 function, several critical factors should be considered:

How can genomic profiling techniques be used to investigate C8orfK29 copy number alterations in disease states?

Genomic profiling for C8orfK29 copy number alterations (CNAs) can be performed using several advanced techniques:

  • Microarray-based comparative genomic hybridization (aCGH):

    • Use bacterial artificial chromosome (BAC)-based aCGH with DNA extracted from microdissected cells of interest

    • Apply appropriate filtering criteria (e.g., confidence level > 88%, mean marker distance < 2.5 kbp) to identify significant CNAs

  • FISH confirmation studies:

    • Select locus-specific FISH probes that map within the genomic coordinates of chromosome 8q24.3

    • Include control DNA FISH probes from the opposite chromosome arm to confirm CNAs relative to the cell's ploidy level

    • Use immunohistochemistry (IHC) staining to identify cells before FISH analysis

  • Data analysis approach:

    • Background correct and normalize the quantified images

    • Evaluate all pairwise correlations between normalized replicates using scatter plots and Pearson's correlations on the log₂ ratios

    • Filter CNAs based on frequency thresholds (e.g., >35% of samples) and statistical significance

A sample data table summarizing C8orfK29 copy number alterations might look like this:

Chromosome locusGene targetCopy number statusConfidenceFrequency in samplesAssociated condition
8q24.3C8orfK29Gain0.8840%Benzene exposure

What methodologies are most effective for analyzing C8orfK29 expression in relation to disease biomarkers?

For analyzing C8orfK29 expression as a potential biomarker:

  • Weighted Gene Co-expression Network Analysis (WGCNA):

    • Build co-expression networks to identify modules of genes with similar expression patterns

    • Calculate Module Membership (MM) and Gene Significance (GS) scores to identify associations between C8orfK29 and clinical traits

    • Select core genes with MM>0.8 and GS>0.2 for further analysis

  • Proteomic validation approaches:

    • Develop ELISA assays using Recombinant Human Putative transmembrane protein C8orfK29 as a standard

    • Establish activation protocols similar to other recombinant proteins using appropriate buffers and enzymes

  • Statistical evaluation:

    • Implement ROC (Receiver Operating Characteristic) analysis to determine the diagnostic potential of C8orfK29 as a biomarker

    • Calculate sensitivity, specificity, and area under the curve (AUC) to assess biomarker performance

  • Integration with clinical data:

    • Correlate C8orfK29 expression levels with clinical parameters

    • Use multivariate analysis to control for confounding factors when assessing biomarker validity

What are the best practices for organizing and analyzing large datasets involving C8orfK29 genomic research?

When managing large datasets from C8orfK29 genomic research:

  • Database structure implementation:

    • Create a relational database that captures relationships between experimental elements, chemical properties, phenotypic results, and genetic background information

    • Go beyond simple datasets to develop a comprehensive database that allows for data mining and exploration

  • Data tables organization:

    • Use workspace data tables to organize and track project data, regardless of cloud storage location

    • Implement tables to organize large amounts of data from different cloud locations, track generated data, and scale workflow analysis

  • Data presentation guidelines:

    • Use tables when showing many precise numerical values and specific data in a small space

    • Use figures when showing trends, patterns, and relationships between datasets

    • Use text when data is limited or when a table would have 2 or fewer columns

Data TypeBest Presentation MethodExample for C8orfK29 Research
Precise numerical valuesTablesProtein expression levels across multiple cell lines
Trends and patternsFiguresChanges in C8orfK29 expression over time
Limited data pointsTextBrief description of initial findings
Presence/absence of characteristicsTablesDetection of C8orfK29 in different tissue types
Relationships between datasetsFiguresCorrelation between C8orfK29 expression and clinical outcomes

How should researchers approach contradictory findings in C8orfK29 functional studies?

When facing contradictory findings in C8orfK29 research:

How is C8orfK29 expression associated with cancer progression and prognosis?

Research indicates that C8orfK29 may have important associations with cancer development:

  • Chromosomal alterations:

    • C8orfK29 is located in chromosome 8q24.3, a region showing gain (amplification) in chromosomal analyses of benzene-exposed workers

    • This chromosomal region has also shown alterations in certain cancer types, suggesting potential involvement in carcinogenesis

  • Potential pathways:

    • As a transmembrane protein, C8orfK29 may function in signaling pathways similar to other TMEM proteins that regulate critical processes like cell migration, invasion, and proliferation

    • Some TMEM proteins influence the TGF-β pathway, which is frequently dysregulated in cancer

  • Research methodology recommendations:

    • Implement WGCNA to identify co-expression networks involving C8orfK29 in cancer datasets

    • Calculate Gene Significance (GS) scores to correlate C8orfK29 expression with clinical traits such as survival and progression

    • Use ROC analysis to evaluate C8orfK29's potential as a prognostic biomarker

  • Experimental approaches:

    • Conduct knockdown or overexpression studies in relevant cancer cell lines to assess functional impact

    • Perform immunohistochemistry on patient samples to correlate expression with clinical outcomes

    • Integrate genomic alterations with transcriptomic and proteomic data for comprehensive analysis

What are the most effective experimental designs for investigating C8orfK29 in cellular signaling pathways?

To investigate C8orfK29's role in cellular signaling:

  • CRISPR/Cas9 gene editing approaches:

    • Generate knockout cell lines to observe the effects on downstream signaling pathways

    • Create point mutations in specific domains to identify critical functional regions

    • Develop knock-in reporter systems to monitor C8orfK29 activity in real-time

  • Protein interaction studies:

    • Implement co-immunoprecipitation experiments to identify binding partners

    • Use proximity ligation assays to detect protein-protein interactions in situ

    • Employ yeast two-hybrid screening to discover novel interactors

  • Signaling pathway analysis:

    • Assess effects on TGF-β/Smad signaling through reporter assays and western blotting

    • Investigate potential impacts on NF-κB activation similar to other transmembrane proteins

    • Examine connections to proliferation pathways through phosphorylation cascade analysis

  • Experimental design considerations:

    • Implement one-factor or multi-factor designs based on the complexity of the pathway

    • Determine whether between-subjects or within-subjects designs are most appropriate

    • Include time course experiments to capture dynamic signaling events

  • Statistical approach:

    • Use power calculations to determine appropriate sample sizes

    • Implement appropriate statistical tests based on data distribution and experimental design

    • Consider interdependencies among genes and expression levels in analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.