Recombinant Human Putative transmembrane protein LOC401397

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SMIM30; Small integral membrane protein 30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM30
Target Protein Sequence
MDSETPKQKARDAKFMLVKRLWQDKDGHLCRIVLHDHGWNPSETPVGPQMHGARSLSMEE SAAAGIVGNVVWRLRPPRHSCNGCFLEGRVTWNLLISASGAPGRENFKSDRILYIPFLGT FSPQDSNIMTSVSTQLSLVLMSLLLVLPVVEAVEAGDAIALLLGVVLSITGICACLGVYA RKRNGQM
Uniprot No.

Target Background

Database Links

HGNC: 48953

UniGene: Hs.117929

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the putative transmembrane protein LOC401397 and how is it classified?

LOC401397 is a putative G protein-coupled transmembrane polypeptide that belongs to the family of predicted transmembrane proteins. Similar to characterized transmembrane proteins, it contains structural domains that span the cell membrane and likely plays roles in cellular signaling or protein-protein interactions. Research indicates that putative transmembrane proteins can become unfolded when overexpressed, potentially leading to ubiquitination and cellular stress responses . Current classification places LOC401397 among proteins with potential roles in cellular homeostasis, though detailed characterization remains ongoing.

What experimental approaches should be used for initial characterization of LOC401397?

For initial characterization, a multi-faceted approach is recommended:

  • Bioinformatic analysis: Employ computational prediction tools to identify potential transmembrane domains, signal peptides, and functional motifs.

  • Expression profiling: Quantify expression across tissues using RT-qPCR and RNA-seq to establish baseline expression patterns.

  • Protein localization: Use fluorescent tagging (GFP fusion constructs) combined with confocal microscopy to determine subcellular localization.

  • Preliminary functional assays: Employ knockdown/overexpression studies to observe phenotypic changes.

Similar to approaches used for IFITM3 characterization, researchers should examine LOC401397's membrane topology using electron paramagnetic resonance (EPR) spectroscopy and nuclear magnetic resonance (NMR) spectroscopy to identify amphipathic regions and potential helical structures .

What expression systems are optimal for producing recombinant LOC401397?

Based on experience with similar transmembrane proteins, the following expression systems are recommended:

Expression SystemAdvantagesLimitationsRecommended for
HEK293 cellsNative post-translational modifications, proper foldingHigher cost, lower yieldFunctional studies, structural analysis
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential inclusion bodiesInitial screening, antibody production
Insect cellsGood for complex mammalian proteins, proper foldingModerate cost, glycosylation differencesScale-up production, crystallography

For optimal results with transmembrane proteins like LOC401397, mammalian expression systems such as HEK293 cells are often preferred as they provide the appropriate cellular machinery for proper folding and post-translational modifications .

What purification strategies address the challenges of transmembrane protein isolation?

Purifying transmembrane proteins like LOC401397 requires specialized approaches:

  • Solubilization: Use mild detergents (CHAPS, DDM, or digitonin) to extract the protein from membranes while maintaining native conformation.

  • Affinity tags: Incorporate a C-terminal polyhistidine tag (6-10×His) for initial purification via immobilized metal affinity chromatography (IMAC) .

  • Buffer optimization: Include glycerol (10-15%) and reducing agents to maintain stability during purification.

  • Size exclusion chromatography: As a final polishing step to remove aggregates and ensure homogeneity.

Lyophilization from a 0.2 μm filtered solution in PBS is recommended for storage, with reconstitution at 100-200 μg/mL in sterile PBS for experimental use .

How do post-translational modifications affect LOC401397 function and localization?

Post-translational modifications likely play crucial roles in LOC401397 function:

  • S-palmitoylation: Similar to IFITM3, LOC401397 may undergo S-palmitoylation at conserved cysteine residues, which would anchor cytoplasmic domains to cellular membranes and induce conformational changes in amphipathic regions . This modification can be studied using molecular dynamics simulation and site-specific lipidation techniques.

  • Phosphorylation: Potential phosphorylation sites may regulate protein-protein interactions and trafficking, as observed with TET2 phosphorylation by AMPK .

  • Ubiquitination: When overexpressed, putative transmembrane proteins can become unfolded and subject to ubiquitination, leading to degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway .

What advanced structural analysis methods are most effective for LOC401397?

For detailed structural characterization:

  • Cryo-electron microscopy: Provides high-resolution structural data while maintaining the protein in a near-native environment.

  • NMR spectroscopy: Particularly useful for identifying dynamic regions and membrane-interacting domains, as demonstrated with IFITM3 .

  • Molecular dynamics simulations: Can predict how modifications like S-palmitoylation might alter protein conformation and membrane interactions .

  • Site-directed mutagenesis combined with functional assays: To validate structural predictions and identify critical residues.

How should experiments be designed to investigate LOC401397 function in cellular pathways?

When designing experiments to investigate LOC401397 function:

  • Define clear hypotheses: Determine whether the experiment aims to test a specific hypothesis or explore research questions that may generate new hypotheses .

  • Pre-specify primary outcome variables: For hypothesis-testing experiments, specify a testable statistical null hypothesis and primary outcome variable .

  • Calculate appropriate sample sizes: Use power analysis based on reasonably firm estimates of effect size and variability .

  • Include proper controls: Both positive and negative controls, including closely related transmembrane proteins with known functions.

  • Document unexpected events: Keep track of protocol deviations and unexpected observations during experimental conduct .

Tables comparing expression levels across different experimental conditions should be included, with statistical analysis of significance.

What knockdown/overexpression approaches are recommended for LOC401397 functional studies?

ApproachMethodologyAdvantagesConsiderations
siRNA knockdownTransfect cells with target-specific siRNAsRapid, relatively simpleTransient effect, potential off-target effects
Locked nucleic acid (LNA)Modified antisense oligonucleotidesImproved knockdown efficiency and stabilityHigher cost, potential cytotoxicity
CRISPR-Cas9Gene editing to create permanent knockoutComplete protein ablation, stable cell linesTime-consuming, potential compensation mechanisms
Inducible overexpressionTetracycline-regulated expression systemControlled expression levels, temporal regulationSystem complexity, leaky expression

When selecting a knockdown approach, consider cell viability concerns. Research shows that siRNA transfection can result in prohibitively low cell viability, while locked nucleic acid (LNA) treatment achieves effective knockdown in T cells with improved viability .

What disease associations have been identified for LOC401397?

Limited direct evidence exists for LOC401397 disease associations, but research frameworks can be established based on similar proteins:

  • Expression analysis in disease states: Differential expression analysis has identified LOC401397 among the top differentially expressed genes (DEGs) in certain disease conditions .

  • Potential neurodegenerative connections: Similar to other unfolded transmembrane proteins like Pael receptor, accumulation of unfolded LOC401397 could potentially lead to cellular stress and contribute to neurodegenerative processes .

  • Cancer implications: Analysis of expression patterns across cancer types can reveal potential associations, as demonstrated for other genes like ESR1, NPY, CCR2, and SLC1A1 in pan-cancer studies .

Further research using patient-derived samples and animal models is needed to establish definitive disease associations.

How can researchers investigate potential pathophysiological mechanisms involving LOC401397?

To investigate pathophysiological mechanisms:

  • Expression correlation studies: Analyze correlations between LOC401397 expression and disease progression or patient outcomes.

  • Animal models: Develop transgenic models with LOC401397 knockout or overexpression to observe phenotypic consequences.

  • Patient-derived samples: Compare LOC401397 expression and post-translational modifications in healthy versus diseased tissues.

  • Cellular stress pathways: Examine how LOC401397 misfolding or overexpression affects cellular stress responses, particularly in the endoplasmic reticulum.

  • Interaction studies: Identify binding partners and signaling pathways potentially affected by LOC401397 dysfunction.

What bioinformatic approaches should be used to analyze LOC401397 expression data?

For comprehensive expression analysis:

  • RNA-seq data processing: Implement a computational pipeline addressing each step of RNA-seq data processing, including quality control, alignment, and normalization .

  • Differential expression analysis: Apply statistical methods like ANOVA followed by SAM (Significance Analysis of Microarrays) analysis and hierarchical clustering to identify conditions where LOC401397 shows significant expression changes .

  • Time-series analysis: For dynamic studies, employ specialized methods for RNA-seq time-series data analysis to capture temporal expression patterns .

  • Integration with other -omics data: Combine transcriptomic data with proteomic and metabolomic datasets for systems-level understanding.

How can researchers predict potential interaction partners and functional networks for LOC401397?

To predict interactions and networks:

  • Protein-protein interaction databases: Query databases like STRING, BioGRID, and IntAct for predicted interactions based on sequence similarity with characterized proteins.

  • Co-expression network analysis: Identify genes consistently co-expressed with LOC401397 across multiple datasets to infer functional relationships.

  • Pathway enrichment analysis: Determine over-represented biological pathways among co-expressed genes.

  • Domain-based interaction prediction: Analyze specific protein domains for potential binding interfaces with known interacting partners of similar proteins.

  • Comparative genomics: Examine evolutionary conservation patterns to identify functionally important regions.

What are the key considerations for ensuring reproducible research with LOC401397?

To ensure reproducibility:

  • Detailed methodology documentation: Record all experimental conditions, reagent sources, and cell passage numbers.

  • Standardized protocols: Develop and follow standard operating procedures (SOPs) for all aspects of LOC401397 research .

  • Statistical analysis plan: Formulate a detailed statistical analysis plan based on the experimental design before conducting the study .

  • Sample size justification: Provide clear justification for sample sizes based on power calculations .

  • Open data sharing: Make raw data, analysis code, and detailed protocols publicly available.

  • Reporting guidelines: Adhere to field-specific reporting guidelines to ensure comprehensive methodology description .

What information should be included when reporting LOC401397 research findings?

A comprehensive research report should include:

  • Experimental design rationale: Clear explanation of why specific approaches were chosen.

  • Detailed methods: Complete description of cell lines, culture conditions, antibodies, primers, and analytical techniques.

  • Controls and validations: Thorough documentation of all controls and validation experiments.

  • Complete dataset presentation: Include all data points, not just representative examples.

  • Statistical analyses: Detailed description of statistical methods, including handling of outliers and corrections for multiple testing.

  • Limitations discussion: Honest assessment of study limitations and potential alternative interpretations.

  • Reproducibility considerations: Identification of potential challenges for reproducing the findings.

What are promising future research directions for LOC401397?

Emerging areas for LOC401397 research include:

  • Single-cell analysis: Investigating cell-type-specific expression patterns and heterogeneity using single-cell RNA-seq.

  • Structure-function relationships: Determining how specific domains contribute to LOC401397 function through systematic mutagenesis.

  • Therapeutic targeting: Exploring potential for modulating LOC401397 activity in disease contexts.

  • Interaction with cellular stress pathways: Examining how LOC401397 relates to unfolded protein response and other stress mechanisms.

  • Evolutionary conservation: Comparative analysis across species to identify critical functional elements.

How can new technologies advance LOC401397 research?

Cutting-edge technologies with potential to advance LOC401397 research:

  • CRISPR screening: Genome-wide functional screens to identify genes that modify LOC401397 phenotypes.

  • Proximity labeling: BioID or APEX2-based approaches to identify proximal proteins in living cells.

  • Advanced imaging: Super-resolution microscopy and live-cell imaging to track dynamics and interactions.

  • Protein engineering: Creating synthetic variants with enhanced stability or novel functions.

  • Organoid models: Studying LOC401397 in more physiologically relevant 3D culture systems.

  • AI-based structural prediction: Leveraging artificial intelligence to predict protein structure and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.