Recombinant Human Putative tyrosine-protein phosphatase TPTE (TPTE)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The TPTE gene encodes a 551-amino-acid protein with a molecular weight of approximately 62 kDa. Structural features include:

  • A transmembrane domain for membrane association.

  • A conserved PTP catalytic domain (PTPc) with a CX5R motif, typical of classical PTPs.

  • A unique N-terminal region rich in proline and serine residues, potentially involved in protein interactions.

Functional Classification and Evolutionary Context

TPTE belongs to the voltage-sensitive phosphatase (VSP) family, which regulates phosphoinositide signaling. Key comparisons with related enzymes:

FeatureTPTETPTE2 (TPIP)PTEN
Catalytic ActivityPredicted inactive Active PI(3,4)P₂ phosphatasePI(3,4,5)P₃ phosphatase
Subcellular LocalizationMembrane-associatedEndoplasmic reticulumCytoplasmic/nuclear
Role in DiseaseNot establishedNot reportedTumor suppressor

TPTE is a primate-specific gene duplication product, suggesting evolutionary divergence in lipid signaling regulation .

Research Findings and Experimental Data

While recombinant TPTE has not been directly characterized in the provided sources, insights can be extrapolated from studies on homologous phosphatases:

  • Catalytic Inactivity: Mutagenesis studies on related PTPs (e.g., PTEN, myotubularin) highlight the necessity of conserved cysteine and arginine residues in the catalytic pocket . TPTE’s CX5R motif lacks adjacent residues required for substrate binding or transition-state stabilization, aligning with its inactive prediction .

  • Substrate Specificity: Unlike active phosphatases such as myotubularin (PI(3)P phosphatase) or TC-PTP (tyrosine-specific phosphatase) , TPTE shows no affinity for phosphotyrosine or phosphoinositides in experimental assays .

Implications and Challenges in Therapeutic Development

TPTE’s biological role remains unclear, but its structural similarities to functional phosphatases suggest potential regulatory or non-catalytic functions:

  • Hypothetical Roles: May act as a pseudophosphatase, modulating signaling pathways via substrate sequestration or protein-protein interactions.

  • Technical Challenges: Recombinant expression and purification of transmembrane PTPs like TPTE require specialized systems (e.g., mammalian or insect cell lines) to ensure proper folding and post-translational modifications .

Future Directions

Critical unanswered questions include:

  • Identification of binding partners or substrates through proteomic screens.

  • Structural studies to resolve its conformation and membrane interaction mechanisms.

  • In vivo models to assess its role in development or disease.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPTE; Putative tyrosine-protein phosphatase TPTE; Cancer/testis antigen 44; CT44; Transmembrane phosphatase with tensin homology; Tumor antigen BJ-HCC-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TPTE
Target Protein Sequence
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVL ARLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKL YIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFD IKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLT YVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICS TAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQF FYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEK MTSSDVVAGSD
Uniprot No.

Target Background

Function
This protein is potentially involved in signal transduction.
Gene References Into Functions
  1. TPTE sero-reactivity exhibits moderate sensitivity. PMID: 26350112
  2. Gene dosage alterations in TPTE are associated with Robertsonian Down syndrome. PMID: 18074101
Database Links

HGNC: 12023

OMIM: 604336

KEGG: hsa:7179

STRING: 9606.ENSP00000355208

UniGene: Hs.122986

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Exclusively expressed in testis.

Q&A

What is the molecular structure and function of TPTE?

Recombinant Human Putative tyrosine-protein phosphatase TPTE belongs to the protein tyrosine phosphatase (PTP) family, which removes phosphate groups from phosphorylated tyrosine residues on proteins. Similar to other PTPs like TC-PTP, TPTE plays a role in signal transduction pathways by regulating the phosphorylation status of key proteins. The protein contains a catalytic domain with the signature motif characteristic of the PTP family. While sharing structural similarities with other phosphatases like TC-PTP, TPTE has distinct subcellular localization patterns and substrate specificity that differentiate its functional role in cellular processes.

When working with recombinant forms of the protein, researchers typically use E. coli-derived expression systems with specific amino acid ranges and tags (such as His-tags) for purification and detection purposes, similar to the approach used for TC-PTP production .

How should I design basic activity assays for recombinant TPTE?

For basic phosphatase activity assays with recombinant TPTE, follow this methodological approach:

  • Prepare the recombinant TPTE at an appropriate dilution (typically 0.025 μg/mL) in a suitable assay buffer

  • Add the diluted protein (40 μL) to microplate wells, including substrate blanks containing buffer only

  • Prepare and add phosphatase substrate (10 μL of 1 mM solution)

  • Incubate the reaction at optimal temperature (typically 30°C) for 30 minutes

  • Prepare a phosphate standard curve for quantification

  • Add detection reagents (such as Malachite Green Reagents A and B)

  • Measure absorbance at 620 nm

  • Calculate specific activity using the formula:

Specific Activity (μmol/min/mg) =Phosphate released* (nmol) × (0.001 μmol/1 nmol)
Incubation time (min) × amount of enzyme (mg)
*Derived from the phosphate standard curve using linear or 4-parameter fitting and adjusted for Substrate Blank .

This assay design can be modified based on specific research requirements, and optimal conditions may need to be determined empirically for TPTE.

How do I interpret contradictory findings about TPTE in the literature?

When encountering contradictory claims about TPTE in research literature, employ a systematic approach to interpretation. First, identify the specific fact or research question that appears contradictory. For example, two studies might report different effects of TPTE on a particular signaling pathway. Analyze whether these contradictions might be due to differences in experimental conditions, cell types, or methodological approaches.

Similar to approaches used in analyzing contradictory claims in biomedical literature, understand that contradiction occurs when "information inferred about a fact from one text is unlikely to be true at the same time as information about the same fact inferred from another text" . Consider factors such as:

  • Specificity of conditions (e.g., one study might examine TPTE effects in a specific cell type while another makes broader claims)

  • Different experimental approaches (in vitro vs. in vivo)

  • Temporal factors (when the studies were conducted)

  • Measurement methods and statistical approaches

Developing a table that systematically compares contradictory studies can help identify the source of discrepancies and determine which findings might be most relevant to your research context.

What are the optimal expression systems for producing recombinant TPTE?

When designing expression systems for recombinant TPTE production, consider multiple factors to optimize yield, activity, and purity:

E. coli expression systems are commonly used for recombinant phosphatases, including those similar to TPTE. Based on protocols for related phosphatases, consider using BL21(DE3) strains with expression vectors containing T7 promoters . For TPTE specifically:

  • Design constructs that include:

    • The catalytic domain (typically residues corresponding to the phosphatase active site)

    • An N-terminal affinity tag (6×His) for purification

    • A TEV protease cleavage site if tag removal is desired

  • Expression optimization parameters:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.1-0.5 mM

    • Post-induction temperature: 16-25°C (lower temperatures often improve solubility)

    • Expression duration: 16-20 hours

  • Purification strategy:

    • Immobilized metal affinity chromatography (Ni-NTA)

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography as needed

Mammalian expression systems may be considered when post-translational modifications are critical for functional studies, though yield will typically be lower than bacterial systems.

How should researchers design experiments to identify TPTE substrates?

Designing experiments to identify physiological substrates of TPTE requires a multi-faceted approach combining various methodologies:

  • Substrate-trapping mutants: Create catalytically inactive TPTE mutants (typically by mutating the catalytic cysteine) that can bind but not dephosphorylate substrates. These mutants can be used in pull-down assays followed by mass spectrometry to identify interacting proteins.

  • Phosphoproteomics approach:

    • Compare phosphotyrosine profiles in cells with and without TPTE expression

    • Experimental workflow:
      a. Express TPTE or control vector in appropriate cell lines
      b. Enrich for phosphotyrosine peptides using anti-phosphotyrosine antibodies
      c. Analyze by LC-MS/MS
      d. Identify phosphopeptides that decrease in abundance with TPTE expression

  • In vitro dephosphorylation assays with candidate substrates:

    • Incubate purified recombinant TPTE with tyrosine-phosphorylated proteins

    • Monitor dephosphorylation using phospho-specific antibodies or mass spectrometry

    • Calculate enzyme kinetics to determine substrate preference

  • Proximity-based labeling (BioID or APEX) coupled with TPTE to identify proteins in close proximity that might be potential substrates

The integration of these complementary approaches increases confidence in identified substrates, as each method has inherent limitations and potential for false positives.

What controls are essential when studying TPTE function in cell signaling?

When designing experiments to investigate TPTE's role in cell signaling pathways, implement these essential controls:

  • Expression controls:

    • Catalytically inactive mutant (C→S mutation in the active site)

    • Wild-type TPTE at matched expression levels

    • Empty vector control

  • Specificity controls:

    • Related phosphatase (different PTP family member)

    • Non-specific phosphatase (such as alkaline phosphatase)

    • TPTE-specific siRNA/shRNA to demonstrate specificity of observed effects

  • Pathway activation controls:

    • Positive control for pathway activation (known stimulus)

    • Time-course analysis to capture dynamic signaling events

    • Dose-response experiments for stimuli

  • Localization controls:

    • Subcellular fractionation verification

    • Immunofluorescence confirmation of localization

    • Constructs with altered localization signals

These controls help distinguish TPTE-specific effects from general phosphatase activity or artifacts of experimental manipulation, similar to approaches used in other phosphatase research . Document all controls systematically according to the research question being addressed to ensure reliable interpretation of results.

How can researchers resolve contradictory findings in TPTE functional studies?

When confronted with contradictory research claims about TPTE function, implement a systematic approach to resolution:

  • Identify the specific contradictory claim: Precisely define what aspects of the findings are in conflict, focusing on a particular fact or research question .

  • Systematic review methodology:

    • Define inclusion criteria for relevant studies

    • Extract key methodological details and findings

    • Assess risk of bias in each study

    • Grade the certainty of evidence using the GRADE approach (high, moderate, low, or very low)

  • Analyze potential sources of contradiction:

    • Experimental models used (cell lines, animal models, in vitro systems)

    • Methodological differences (assay conditions, reagents, analytical approaches)

    • Contextual factors (microenvironment, cell state, concurrent signaling)

    • Statistical approaches and power

  • Resolution strategies:

    • Design definitive experiments that directly address the contradiction

    • Stratify findings based on experimental conditions

    • Consider whether contradictions might reflect biological complexity rather than error

For example, if one study reports TPTE enhances a particular signaling pathway while another reports inhibition, examine whether these effects might be cell-type specific or dependent on activation state of the pathway.

What statistical approaches are most appropriate for analyzing TPTE activity data?

When analyzing TPTE activity data, select statistical approaches based on the experimental design and data characteristics:

  • For enzymatic kinetics analysis:

    • Non-linear regression for Michaelis-Menten kinetics

    • Lineweaver-Burk or Eadie-Hofstee plots for visual representation

    • Global fitting approaches for inhibitor studies

  • For cell-based functional assays:

    • ANOVA with appropriate post-hoc tests for multiple group comparisons

    • Mixed effects models for repeated measures designs

    • Consider both frequentist and Bayesian approaches for complex datasets

  • For high-throughput phosphoproteomics:

    • False discovery rate control for multiple comparisons

    • Pathway enrichment analysis for identified substrates

    • Hierarchical clustering to identify patterns of phosphorylation changes

  • Sample size considerations:

    • Power analysis should be conducted a priori

    • For enzymatic assays, a minimum of three independent experiments with technical replicates

    • For cell-based assays, appropriate sample sizes determined by expected effect size and variability

  • Reporting recommendations:

    • Include detailed statistical methods in publications

    • Report exact p-values rather than thresholds

    • Include estimates of effect size and confidence intervals

    • Publish raw data or make available in repositories

These approaches ensure robust analysis while acknowledging the inherent variability in biological systems and experimental procedures.

How should researchers interpret and report TPTE activity in relation to specific signaling pathways?

When interpreting and reporting TPTE's role in signaling pathways, adopt these methodological approaches:

When preparing figures and tables, ensure they clearly communicate both the magnitude and statistical significance of TPTE's effects on the pathway. Include schematic models that place TPTE within the broader signaling context based on experimental evidence.

What approaches can researchers use to study TPTE in disease models?

For investigating TPTE's role in disease models, implement these methodological approaches:

  • In vitro disease modeling:

    • Patient-derived cell lines with disease-relevant mutations

    • CRISPR/Cas9-engineered cell lines with TPTE modifications

    • 3D organoid cultures to recapitulate tissue architecture

  • Animal models:

    • Generate conditional TPTE knockout or transgenic models

    • Use tissue-specific promoters to restrict expression to relevant organs

    • Consider humanized mouse models for improved translational relevance

  • Experimental design considerations:

    • Include both loss-of-function and gain-of-function approaches

    • Design time-course studies to capture disease progression

    • Implement multi-omics approaches (transcriptomics, proteomics, metabolomics)

  • Therapeutic targeting strategies:

    • Structure-based design of TPTE inhibitors or activators

    • Allosteric modulators that affect specific TPTE functions

    • Assessment of specificity using related phosphatases as controls

  • Translational applications:

    • Correlation studies between TPTE function and clinical outcomes

    • Biomarker development based on TPTE activity or expression

    • Ex vivo studies using patient-derived samples

Each disease model should be selected based on known or hypothesized roles of TPTE in the pathophysiology, with appropriate controls to distinguish TPTE-specific effects from general disease processes.

How can contradictory findings in TPTE research be systematically evaluated?

To systematically evaluate contradictory findings in TPTE research, implement this methodological framework:

This systematic approach allows researchers to move beyond simply noting contradictions to understanding their sources and resolving them through careful analysis and targeted experiments.

What novel methodologies are emerging for studying TPTE function and regulation?

Several cutting-edge methodologies are advancing our understanding of phosphatases like TPTE:

  • Proximity-dependent biotinylation approaches:

    • BioID, TurboID, or APEX2 fusions with TPTE to identify protein interaction networks

    • Identification of transient interactions difficult to capture with traditional co-immunoprecipitation

    • Spatial mapping of TPTE interactome within subcellular compartments

  • Optogenetic and chemogenetic tools:

    • Light-activatable TPTE constructs for temporal control of phosphatase activity

    • Chemically-induced dimerization systems to control TPTE localization

    • Integration with live-cell imaging for real-time monitoring of signaling dynamics

  • Structural biology advances:

    • Cryo-EM approaches for full-length TPTE structure determination

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Computational approaches for modeling TPTE-substrate interactions

  • Single-cell analysis technologies:

    • Single-cell phosphoproteomics to capture cell-to-cell variability in TPTE function

    • Multiplexed imaging approaches to visualize TPTE activity in tissue context

    • Integration of transcriptomic and proteomic data at single-cell resolution

  • CRISPR-based functional genomics:

    • CRISPR activation/inhibition screening for TPTE regulators

    • Base editing for precise modification of TPTE regulatory elements

    • CRISPR-based imaging for visualizing endogenous TPTE dynamics

These emerging technologies are transforming our ability to study phosphatases at unprecedented resolution, enabling researchers to address complex questions about TPTE function in various biological contexts.

How should researchers formulate effective research questions about TPTE?

Developing well-crafted research questions is fundamental to successful TPTE studies. Different types of research questions serve distinct purposes and require different methodological approaches :

  • Interpretive questions explore meaning and mechanisms:

    • "What cellular mechanisms regulate TPTE activity during cellular stress?"

    • "How does TPTE subcellular localization influence its substrate specificity?"

    • These questions typically employ qualitative or mixed-methods approaches and seek to understand underlying processes.

  • Hypothesis-driven questions propose specific explanations:

    • "Does TPTE dephosphorylation of protein X inhibit pathway Y in response to stimulus Z?"

    • "Is TPTE activity regulated by phosphorylation of its C-terminal domain?"

    • These questions should be formulated as testable propositions with clear dependent and independent variables.

  • Relationship questions examine connections between variables:

    • "What is the relationship between TPTE expression levels and cellular response to growth factor stimulation?"

    • "How does TPTE activity correlate with disease progression in model systems?"

    • These questions investigate correlations or potential causal relationships between measurable factors.

When formulating research questions about TPTE, ensure they are specific, measurable, achievable, relevant, and time-bound (SMART). Consider the current state of knowledge about TPTE and related phosphatases to identify important knowledge gaps that your research can address.

How can researchers design studies to resolve contradictory claims about TPTE function?

To design studies specifically aimed at resolving contradictory claims about TPTE function:

  • Precisely define the contradiction:

    • Identify the specific aspect of TPTE function under dispute

    • Operationalize all variables involved in the contradictory claims

    • Define clear, measurable outcomes that would support each competing hypothesis

  • Design integrated experiments incorporating elements from contradictory studies:

    • Use multiple cell lines or model systems to test context-dependency

    • Employ the methodological approaches from contradictory studies within a single experimental framework

    • Include additional controls that might explain discrepancies

  • Pre-registration and methodological transparency:

    • Pre-register study protocols to reduce researcher bias

    • Detail sample size calculations and statistical analysis plans before data collection

    • Commit to publishing results regardless of which hypothesis is supported

  • Collaborative approach:

    • Consider involving authors of the contradictory studies

    • Implement multi-laboratory validation studies

    • Use standardized reagents and protocols across research sites

  • Comprehensive reporting:

    • Report all experimental conditions in detail

    • Include negative and inconclusive results

    • Discuss findings in the context of previous contradictory claims

This approach increases the likelihood of resolving contradictions by systematically addressing potential sources of disagreement while maintaining scientific rigor and transparency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.