Recombinant Human Putative uncharacterized protein C18orf15 (C18orf15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C18orf15; Putative uncharacterized protein C18orf15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C18orf15
Target Protein Sequence
MQGQGALKESHIHLPTEQPEASLVLQGQLAESSALGPKGALRPQAQSPDVPVSWWQGSGK RLSHRLPHICSQPPLGPFLPLTWPSCGFFGLGGAASASLGLEVLQDSVSTWARGPCCPVH PQSLTVVCMCACMCVCVHVCACVYVCMCVLVCMCACACMRAHRYFLMDCAGICSPHGPGT Q
Uniprot No.

Target Background

Database Links

HGNC: 26447

UniGene: Hs.675872

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C18orf15 and what are its alternative names?

C18orf15 (chromosome 18 open reading frame 15) is a 181 amino acid protein encoded by a gene located on human chromosome 18 . It is also known by several alternative names, including HsT3231 and MYCBPAP (MYC Binding Protein Associated Protein) . The protein is relatively less characterized within the human proteome, with research still ongoing to fully elucidate its function and significance within cellular physiology . The gene is specifically located on the long arm of chromosome 18, at position 18q12.1, and encodes what is currently considered a putative uncharacterized protein .

What information is available about the gene encoding C18orf15?

The C18orf15 gene is situated on human chromosome 18, which houses over 300 protein-coding genes and contains nearly 76 million bases . The specific locus for this gene is on the long arm of chromosome 18, denoted as 18q12.1 . Chromosome 18 is associated with various diseases, including Trisomy 18 (Edwards syndrome), Niemann-Pick disease, hereditary hemorrhagic telangiectasia, erythropoietic protoporphyria, and follicular lymphomas . Early research on chromosome 18-specific brain transcripts identified C18orf15 as part of studies investigating positional candidates for bipolar disorder, suggesting potential neurological significance .

What hypothetical cellular pathways might C18orf15 participate in?

Given its association with MYC, C18orf15/MYCBPAP may participate in several critical cellular pathways including cell cycle regulation, transcriptional control, and metabolic processes . As MYC dysregulation is implicated in the development of various cancers, proteins that interact with MYC, like MYCBPAP, are of considerable interest for their potential role in oncogenesis . The membrane localization of C18orf15 suggests it might also function in signal transduction pathways, potentially serving as a link between membrane-associated signaling events and MYC-mediated transcriptional responses. Research into these pathways remains ongoing, and experimental validation of these hypothetical functions represents an important area for future investigation.

How might researchers approach identifying novel protein interactions with C18orf15?

To identify novel protein interactions with C18orf15, researchers could employ several complementary approaches. Co-immunoprecipitation assays using anti-C18orf15 antibodies, such as the rabbit polyclonal antibody targeting the 39-89 amino acid region, could help isolate protein complexes containing C18orf15 . These complexes could then be analyzed using mass spectrometry to identify interacting partners. Yeast two-hybrid screening or proximity-based labeling methods like BioID or APEX could also be used to identify proteins in close proximity to C18orf15 within cellular contexts. Given the known association with MYC, targeted approaches to validate and characterize this specific interaction would be particularly valuable for understanding C18orf15's functional role.

What antibodies and detection methods are available for studying C18orf15?

Several antibodies have been developed for the detection and study of C18orf15 in research applications. A rabbit polyclonal antibody (STJ194687) against the putative uncharacterized protein C18orf15 is available and has been validated for use in Western Blot applications . This antibody specifically targets the amino acid region 39-89 of human C18orf15 and can detect endogenous levels of the protein . The recommended dilution range for Western Blot applications is 1:500-2000 . The antibody was affinity-purified from rabbit antiserum using epitope-specific immunogen, suggesting high specificity . Additionally, this antibody shows reactivity with human, rat, and mouse samples, making it suitable for comparative studies across these species .

What are the recommended protocols for detecting C18orf15 in experimental samples?

For Western Blot detection of C18orf15, researchers should follow standard protocols with some specific considerations. The antibody should be diluted within the recommended range of 1:500-2000 in appropriate blocking buffer . Incubation should typically be performed at 4°C overnight for optimal results, as demonstrated in validation studies using VEC cells . The antibody is supplied in a liquid formulation containing PBS with 50% glycerol, 0.5% BSA, and 0.02% sodium azide . For storage, it is recommended to keep the antibody at -20°C for up to 1 year from the date of receipt while avoiding repeated freeze-thaw cycles to maintain its efficacy . When designing experiments, appropriate positive controls (such as VEC cells) and negative controls should be included to validate specificity of detection.

What experimental considerations should be taken when studying membrane proteins like C18orf15?

When studying membrane proteins like C18orf15, several experimental considerations are crucial for successful outcomes. First, sample preparation methods must effectively solubilize membrane proteins without denaturing them beyond recognition by antibodies. Detergents such as Triton X-100, NP-40, or specialized membrane protein extraction buffers should be optimized for C18orf15 extraction. Second, when performing Western blot analysis, transfer conditions may need adjustment, as membrane proteins can be more challenging to transfer efficiently to membranes compared to soluble proteins. Third, blocking conditions may require optimization to reduce background while maintaining specific binding. Finally, researchers should consider using membrane fraction enrichment procedures prior to analysis to increase the concentration of the target protein in their samples.

What is the potential significance of C18orf15's interaction with MYC in disease contexts?

The association of C18orf15/MYCBPAP with MYC positions it as a potentially important factor in disease contexts where MYC signaling is implicated . MYC is a well-known proto-oncogene that plays critical roles in cell cycle progression, apoptosis, and cellular transformation . Dysregulation of MYC is implicated in the development of various cancers, making proteins that interact with MYC, like MYCBPAP, of considerable interest for their potential role in oncogenesis . The interaction between C18orf15 and MYC could influence MYC-mediated transcriptional regulation, potentially affecting processes like cell proliferation and metabolism that are frequently altered in disease states . Understanding this interaction could provide insights into disease mechanisms and potentially identify novel therapeutic targets in conditions where MYC signaling is dysregulated.

How can CRISPR-Cas9 genome editing be applied to study C18orf15 function?

CRISPR-Cas9 genome editing represents a powerful approach for investigating C18orf15 function through several strategies. Researchers could generate knockout cell lines by introducing frameshift mutations or large deletions in the C18orf15 gene, allowing for the study of phenotypic consequences of complete protein loss. Alternatively, knock-in strategies could introduce tagged versions of C18orf15 (such as GFP or FLAG tags) at the endogenous locus to facilitate protein visualization and pulldown experiments while maintaining native expression regulation. For studying specific domains, precise editing could introduce mutations in regions of interest, such as the 39-89 amino acid region recognized by available antibodies , or in predicted functional domains. Additionally, CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems could be employed to modulate C18orf15 expression levels without permanently altering the genomic sequence, allowing for temporal control of expression studies.

What approaches can be used to characterize the membrane topology of C18orf15?

Characterizing the membrane topology of C18orf15 as a single-pass membrane protein requires specialized techniques that can determine which portions of the protein are exposed to different cellular compartments. Protease protection assays using isolated membrane fractions can identify domains protected from digestion, indicating their location within the membrane or on the protected side. Glycosylation mapping, utilizing the fact that glycosylation occurs in the lumen of the endoplasmic reticulum, can help determine which portions of the protein enter the secretory pathway. Epitope insertion followed by immunofluorescence in permeabilized versus non-permeabilized cells can reveal which portions are accessible from each side of the membrane. Computational prediction tools like TMHMM, Phobius, or TOPCONS can provide initial models of transmembrane regions and topology, which can then be experimentally validated using these biochemical approaches.

How can researchers study the potential role of C18orf15 in MYC-mediated transcriptional regulation?

To investigate C18orf15's role in MYC-mediated transcriptional regulation, researchers could employ a multi-faceted approach combining molecular, cellular, and genomic techniques. Chromatin immunoprecipitation (ChIP) assays using antibodies against both MYC and C18orf15 could determine if C18orf15 co-localizes with MYC at specific genomic loci. RNA sequencing analysis comparing gene expression profiles between wild-type cells and those with C18orf15 knockdown/knockout could identify genes whose expression depends on C18orf15, particularly focusing on known MYC target genes. Co-immunoprecipitation followed by mass spectrometry could identify additional components of the transcriptional complexes containing both MYC and C18orf15. Reporter assays using MYC-responsive promoters could determine if C18orf15 modulates MYC-dependent transcriptional activity. Finally, proximity ligation assays (PLA) could visualize and quantify interactions between MYC and C18orf15 in situ within cells, providing spatial context for their association.

Known Characteristics of Human C18orf15 Protein

FeatureDescriptionEvidence Source
Protein Length181 amino acids
Alternative NamesHsT3231, MYCBPAP
Chromosomal Location18q12.1
Cellular LocalizationMembrane (Single-Pass Membrane Protein)
Associated ProteinsMYC (proto-oncogene)
Antibody Target Region39-89 amino acids
Uniprot IDCR015_HUMAN

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.