Recombinant Human Putative uncharacterized protein C18orf62 (C18orf62)

What is C18orf62/SMIM21?

C18orf62 (chromosome 18 open reading frame 62) is a human protein now designated as SMIM21 (Small Integral Membrane Protein 21). It is classified as a putative uncharacterized protein with aliases including MGC126049 . The protein contains the amino acid sequence RNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE, which has been used to develop antibodies for research purposes . Despite its designation as an "uncharacterized protein," evidence suggests potential roles in neuropsychiatric conditions, particularly mood disorders associated with chromosome 18q deletions .

Where is C18orf62 located in the human genome?

C18orf62 is located on the long arm of chromosome 18 (18q). More specifically, it is situated within a critical region associated with mood disorders in patients with distal 18q deletions. Studies examining patients with 18q deletions have identified a critical region that includes C18orf62 along with two other genes, ZADH2 and TSHZ1 . This region is likely within the most distal 30 Mb of chromosome 18, as 95% of individuals with 18q deletions studied were hemizygous for some portion of this region .

How does C18orf62 expression manifest in different tissues?

Detection of C18orf62 expression can be accomplished using immunohistochemistry techniques. Commercially available antibodies for C18orf62/SMIM21 have been validated for immunohistochemistry in both fresh and paraffin-embedded human tissue samples . The recommended dilution range for these applications is 1:200 - 1:500 . While comprehensive tissue expression profiling data is limited in the available literature, researchers can use these immunohistochemical methods to investigate expression patterns across various human tissues of interest.

What is the relationship between C18orf62 and mood disorders?

C18orf62 has been implicated in mood disorders through studies of patients with distal 18q deletions. In one study examining 36 participants with hemizygous distal deletions of chromosome 18q, 16 individuals were identified with lifetime mood disorders (14 with unipolar depression and 2 with bipolar disorders) . Analysis of these patients defined a critical region that included three genes: C18orf62, ZADH2, and TSHZ1 . This suggests that hemizygosity for C18orf62 may contribute to the pathogenesis of mood disorders, although the specific molecular mechanisms remain to be elucidated.

What distinguishes patients with 18q deletions who develop mood disorders from those who don't?

Patients with 18q deletions who developed mood disorders showed several distinguishing characteristics compared to those without mood disorders. The mood-disordered patients had:

These findings suggest that the neuropsychiatric phenotype associated with C18orf62 hemizygosity may be complex and modulated by other factors affecting cognitive function and neurodevelopment.

What other phenotypes are associated with the genomic region containing C18orf62?

The distal region of chromosome 18q is associated with multiple phenotypes beyond mood disorders. Studies have identified critical regions for several clinical features:

While the exact position of C18orf62 relative to these critical regions isn't specified in the available data, the overlap between these regions suggests potential roles for C18orf62 or nearby genes in multiple developmental processes .

What antibodies are available for detecting C18orf62/SMIM21?

Commercially available polyclonal antibodies for C18orf62/SMIM21 have been developed against a recombinant protein corresponding to the amino acid sequence RNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE . These rabbit IgG antibodies have been affinity purified and validated for:

• Immunohistochemistry (fresh samples)

• Immunohistochemistry-Paraffin (embedded samples)

The recommended dilution range is 1:200 - 1:500 . The specificity of these antibodies has been verified on a protein array containing the target protein plus 383 other non-specific proteins, suggesting high specificity for research applications .

How can I generate stable cell lines overexpressing C18orf62 for functional studies?

Stable cell lines overexpressing C18orf62 can be generated using lentiviral expression systems. The general methodology involves:

• Subcloning the C18orf62 gene into appropriate lentiviral vectors

• Generating lentiviral particles containing the C18orf62 construct

• Infecting appropriate host cell lines (HEK293 is commonly used, but CHO and other cell types are also viable options)

• Selecting clones that consistently express C18orf62 at high levels

Commercially available C18orf62-overexpressing stable cell lines have been developed using HEK293 cells, which can serve as positive controls or research tools for functional studies .

What quantitative methods can be used to assess C18orf62 expression levels?

Quantitative real-time PCR (qRT-PCR) can be employed to measure C18orf62 expression levels in research samples. While not specifically described for C18orf62, the methodology would be similar to that used for other genes in the chromosome 18q region:

• Design TaqMan probe/primer sets from genomic sequence data in regions of interest

• Use a real-time PCR detection system (such as Bio-Rad iCycler iQ)

• Quantify target sequence by measuring threshold cycle number (Ct value)

• Use a standard curve and housekeeping gene as an internal control reference

• Calculate relative expression levels based on fractional Ct values

This approach allows precise quantification of C18orf62 expression in experimental samples compared to controls.

How might C18orf62 function be predicted through bioinformatic approaches?

Given the limited characterization of C18orf62/SMIM21, bioinformatic approaches offer valuable insights into potential functions:

• Sequence homology analysis: Compare the amino acid sequence with characterized proteins to identify functional domains

• Secondary structure prediction: Determine potential membrane-spanning regions consistent with its designation as a Small Integral Membrane Protein

• Protein-protein interaction prediction: Identify potential binding partners based on sequence motifs

• Expression correlation analysis: Examine co-expression patterns with genes of known function across tissue types and disease states

• Evolutionary conservation analysis: Assess conservation across species to identify functionally important regions

These approaches can generate testable hypotheses about C18orf62 function that can guide experimental design.

What cellular pathways might be affected by C18orf62 based on current evidence?

Based on the association of C18orf62 with mood disorders, several cellular pathways warrant investigation:

• Neurotransmitter signaling pathways: Given the mood disorder connection, serotonergic, dopaminergic, or noradrenergic signaling might be affected

• Stress response pathways: Mood disorders often involve dysregulation of stress response mechanisms

• Synaptic plasticity: Proteins involved in mood regulation often affect synaptic function

• Neuroendocrine signaling: The association with growth hormone response failure in the same chromosomal region suggests potential roles in endocrine regulation

• Developmental pathways: The multiple developmental phenotypes associated with the region (kidney malformation, dysmyelination) suggest potential roles in tissue development

Experimental approaches that investigate these pathways may reveal the functional significance of C18orf62.

How can CRISPR-Cas9 be utilized to study C18orf62 function?

CRISPR-Cas9 genome editing provides powerful approaches to study C18orf62 function:

• Gene knockout: Create complete loss-of-function models by introducing frameshift mutations or large deletions

• Knockin reporters: Insert fluorescent tags to monitor endogenous protein localization and expression

• Domain-specific mutations: Introduce specific mutations to assess the function of predicted domains

• Transcriptional modulation: Use CRISPRa (activation) or CRISPRi (interference) to modulate expression without altering the coding sequence

• Humanized models: Introduce human C18orf62 into model organisms to study function in vivo

When designing CRISPR studies, researchers should consider the potential for off-target effects and validate editing efficiency through sequencing.

What are the key challenges in studying uncharacterized proteins like C18orf62?

Several challenges complicate research on uncharacterized proteins like C18orf62:

• Limited baseline knowledge: Without established functions or pathways, experimental design must be largely exploratory

• Potential redundancy: Functional redundancy with other proteins may mask phenotypes in single-gene manipulation studies

• Context-dependent functions: The protein may function differently across tissues or developmental stages

• Technical limitations: Lack of validated reagents specific to the protein may hinder experimental approaches

• Publication bias: Negative results may go unpublished, leading to information gaps in the field

Researchers must adopt flexible, multi-dimensional approaches and collaborate across disciplines to overcome these challenges.

How can multi-omics approaches advance understanding of C18orf62 function?

Integrative multi-omics approaches offer powerful means to characterize C18orf62:

• Transcriptomics: RNA-seq analysis comparing wild-type and C18orf62-manipulated samples can identify affected pathways

• Proteomics: Mass spectrometry-based approaches can identify binding partners and post-translational modifications

• Metabolomics: Profiling metabolic changes in response to C18orf62 manipulation may reveal functional roles

• Epigenomics: Analysis of chromatin accessibility and modification in relation to C18orf62 expression

• Systems biology integration: Computational integration of multiple data types can reveal emergent properties not evident in single-omics approaches

These approaches, while technically and computationally challenging, provide comprehensive insights into protein function that overcome limitations of individual techniques.