Recombinant Human Putative uncharacterized protein C5orf60 (C5orf60)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
C5orf60; Uncharacterized protein C5orf60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C5orf60
Target Protein Sequence
MPRAQLPEDSSAVDMDILFPLDSVIGTELCPSPIPQIIHFVLFVVFSLVILIILRLYIPR EPSSVPPREEDSENDQAEVGEWLRIGNKYITLKDYRILLKELENLEIYTFLSKKCLKKLS REGSSHHLPRQVRPGPVYKPAPARNHRPRGGRGKASPTSFHVSPRAPLAPLASMPSSVPK TSVESLGSPSSLSSSKPREPLCPLKHPSHQPPASTLSPNPTSSTESLGYLSSLSSSQPPE PLRPLKHPSHKPRGRSLPRRRNPGWVSWSDSMQADSETDTIICPMCKAPERSCPHTWWVP SSPRVIRGVGRCSDPNLGLSWRQEAARAWCHCTSSQFPFKHPNLPTHLPKASF
Uniprot No.

Target Background

Database Links

HGNC: 27753

KEGG: hsa:285679

UniGene: Hs.558748

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are available for producing recombinant C5orf60?

For recombinant production of C5orf60, several expression systems have been validated with varying efficacy:

  • Cell-free protein synthesis (CFPS): The ALiCE® expression system based on Nicotiana tabacum has successfully produced recombinant C5orf60 with a Strep Tag . This system offers advantages for potentially difficult-to-express proteins, including those requiring post-translational modifications.

  • Bacterial expression systems: While traditional E. coli systems can be used, researchers should consider codon optimization for efficient expression and use fusion tags to enhance solubility.

  • Mammalian cell expression: Particularly valuable when studying protein interactions in a more native cellular context.

When selecting an expression system, consider:

  • Required post-translational modifications

  • Downstream application requirements

  • Solubility concerns

  • Yield requirements

For most academic research applications, the cell-free system offers a balance of yield and proper folding for functional studies .

How is C5orf60 expression correlated with cervical cancer prognosis?

Research published in Frontiers in Genetics (2019) identified C5orf60 as a component of a nine-lncRNA signature that predicts recurrence in cervical cancer . Within this prognostic model, C5orf60 has a positive coefficient (0.13987057), indicating that higher expression levels correlate with shorter disease-free survival and increased recurrence risk .

The complete nine-lncRNA signature risk score formula is:

Risk score = (3.31562585 × ATXN8OS) + (0.13987057 × C5orf60) + (-0.43216636 × DIO3OS) + (-0.92247218 × EMX2OS) + (1.13309789 × INE1) + (-4.48055889 × KCNQ1DN) + (-0.08067727 × KCNQ1OT1) + (-0.09737496 × LOH12CR2) + (-0.66622831 × RFPL1S)

This signature demonstrated significant prognostic capabilities across different FIGO stages of cervical cancer. The researchers validated the signature using multiple cohorts, including a GEO training set, GEO validation set, and TCGA test set, where the lncRNA signature showed higher predictive accuracy (AUC > 0.75) than FIGO staging alone .

Table 1: Components of the Nine-lncRNA Signature for Cervical Cancer Prognosis

GeneCoefficientImpact on Prognosis
ATXN8OS3.31562585Higher expression = worse prognosis
C5orf600.13987057Higher expression = worse prognosis
DIO3OS-0.43216636Higher expression = better prognosis
EMX2OS-0.92247218Higher expression = better prognosis
INE11.13309789Higher expression = worse prognosis
KCNQ1DN-4.48055889Higher expression = better prognosis
KCNQ1OT1-0.08067727Higher expression = better prognosis
LOH12CR2-0.09737496Higher expression = better prognosis
RFPL1S-0.66622831Higher expression = better prognosis

What CRISPR methodologies are recommended for functional C5orf60 studies?

For uncharacterized proteins like C5orf60, CRISPR-based approaches offer powerful tools for functional characterization:

  • CRISPR Activation (CRISPRa): Particularly valuable for studying C5orf60, CRISPRa utilizes a catalytically inactive Cas9 (dCas9) fused to transcriptional activators to enhance endogenous gene expression . Commercial C5orf60 CRISPR Activation Plasmids incorporate:

    • dCas9-VP64 fusion

    • sgRNA optimized for C5orf60 targeting

    • MS2-P65-HSF1 fusion protein for synergistic activation

The synergistic activation mediator (SAM) transcription activation system maximizes endogenous gene expression, allowing researchers to study gain-of-function phenotypes without the confounding factors of ectopic overexpression systems .

  • CRISPR Knockout (KO): For loss-of-function studies, standard CRISPR-Cas9 can be employed with sgRNAs targeting critical exons of C5orf60. When designing knockout strategies, consider:

    • Targeting early exons to maximize disruption

    • Creating frameshifts to induce nonsense-mediated decay

    • Using multiple sgRNAs to ensure complete knockout

    • Validating knockout at both RNA and protein levels

  • CRISPR Interference (CRISPRi): For reversible and tunable repression, CRISPRi employing dCas9-KRAB can be valuable for temporal studies.

How can researchers validate C5orf60's role in the cervical cancer prognostic signature?

To validate and extend the findings regarding C5orf60's role in cervical cancer prognosis, researchers should implement a multi-faceted approach:

  • Expression validation:

    • Perform RT-qPCR analysis of C5orf60 in independent patient cohorts

    • Correlate with clinical outcomes using Kaplan-Meier survival analysis

    • Use multivariate Cox regression to adjust for clinical covariates

    • Validate at protein level using immunohistochemistry if antibodies are available

  • Functional validation:

    • Manipulate C5orf60 expression in cervical cancer cell lines using CRISPR activation or knockdown

    • Assess phenotypic changes in:

      • Proliferation rates

      • Migration and invasion capacity

      • Response to chemotherapeutics

      • Radiation sensitivity

    • Perform xenograft studies to evaluate in vivo tumor growth and metastasis

  • Mechanistic studies:

    • RNA-Seq after C5orf60 manipulation to identify downstream effectors

    • Chromatin immunoprecipitation (ChIP-seq) to identify potential regulatory elements

    • Protein interaction studies to identify binding partners

    • Metabolomic profiling to detect metabolic alterations

Table 2: Experimental Design for C5orf60 Validation in Cervical Cancer Studies

Study ComponentMethodologyKey MeasurementsControls
Clinical ValidationRT-qPCR, IHCExpression levels, correlation with survivalNormal cervical tissue, other cancer types
Cell Line StudiesCRISPR activation/knockoutProliferation, migration, invasion, drug responseNon-targeting sgRNA controls
Animal StudiesXenograft modelsTumor growth, metastasis, survivalVector-only controls
Multi-omicsRNA-Seq, proteomicsAltered pathways, networksTime-matched controls

What bioinformatic approaches can predict C5orf60 function in the absence of experimental data?

For uncharacterized proteins like C5orf60, computational approaches provide crucial starting points for hypothesis generation:

  • Sequence-based analysis:

    • Homology detection using PSI-BLAST, HHpred, or HMMER

    • Domain prediction using InterPro, SMART, or Pfam

    • Secondary structure prediction using PSIPRED or JPred

    • Disorder prediction using PONDR or IUPred

    • Transmembrane topology prediction using TMHMM or Phobius

  • Structure-based prediction:

    • Template-based modeling using Swiss-Model or I-TASSER

    • Ab initio modeling using Rosetta or AlphaFold2

    • Binding site prediction using CASTp or COACH

    • Molecular dynamics simulations to evaluate stability and dynamics

  • Network-based approaches:

    • Co-expression analysis across tissue types and conditions

    • Protein-protein interaction predictions using STRING or GeneMANIA

    • Pathway enrichment analysis using databases like KEGG or Reactome

    • Integrative multi-omics approaches combining transcriptomic, proteomic, and metabolomic data

These computational predictions should guide experimental design rather than serving as definitive functional assignments.

What data tables and visualizations are most informative for C5orf60 research?

When analyzing and presenting C5orf60 research data, consider these table formats and visualizations:

How should researchers approach protein-protein interaction studies for C5orf60?

Understanding the interactome of uncharacterized proteins like C5orf60 is crucial for deciphering their biological function. A comprehensive approach includes:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged C5orf60 (e.g., with Strep tag as in commercially available constructs )

    • Perform pull-down experiments under various conditions

    • Identify binding partners via LC-MS/MS

    • Validate key interactions with co-immunoprecipitation

    • Use crosslinking MS for transient interactions

  • Proximity-based methods:

    • BioID or TurboID fusion proteins for proximity labeling

    • APEX2 for subcellular mapping

    • Split-BioID for condition-dependent interactions

  • Yeast two-hybrid screening:

    • Construct C5orf60 bait proteins (consider domain-specific constructs)

    • Screen against human cDNA libraries

    • Validate hits with orthogonal methods

  • In silico prediction and validation:

    • Use computational tools (STRING, PrePPI) to predict interactions

    • Prioritize high-confidence predictions for experimental validation

    • Consider structural modeling of potential interactions

When analyzing interaction data, focus on network visualization and pathway enrichment to contextualize findings within biological processes.

What is the optimal protocol for recombinant C5orf60 expression and purification?

Based on available data on C5orf60 protein production, the following protocol is recommended:

Cell-Free Protein Synthesis (CFPS) Method:

  • Preparation:

    • Utilize the Almost Living Cell-Free Expression System (ALiCE®) based on Nicotiana tabacum lysate

    • Prepare expression template with C5orf60 coding sequence optimized for the system

    • Include Strep-Tag coding sequence for purification

  • Expression:

    • Combine template DNA with ALiCE® reaction mixture containing:

      • Cell lysate with protein production machinery

      • Amino acids and cofactors

      • Energy regeneration system

    • Incubate at optimal temperature (typically 25-30°C) for 12-24 hours

    • Monitor expression using small-scale test reactions

  • Purification:

    • Perform one-step Strep-tag purification using Strep-Tactin resin

    • Elute with desthiobiotin-containing buffer

    • Analyze purity by SDS-PAGE, Western Blot and analytical SEC (HPLC)

  • Quality Control:

    • Verify identity by mass spectrometry

    • Assess structural integrity via circular dichroism

    • Test functionality through appropriate binding assays

This expression system is particularly valuable for C5orf60 as it supports post-translational modifications that may be essential for proper folding and function .

What experimental design is optimal for studying C5orf60 in cervical cancer models?

An optimal experimental design for investigating C5orf60 in cervical cancer should include:

Table 4: Comprehensive C5orf60 Research Plan for Cervical Cancer Studies

PhaseApproachKey MethodsExpected Outcomes
1. Baseline CharacterizationExpression profiling- RT-qPCR across cervical cancer cell lines
- IHC in patient samples
- Analysis of public datasets
- Baseline expression patterns
- Correlation with clinical parameters
2. Functional AssessmentGain/loss-of-function- CRISPR activation with SAM system
- CRISPR knockout
- Phenotypic assays
- Effect on proliferation, migration, invasion
- Changes in gene expression profiles
3. Mechanism ExplorationPathway analysis- RNA-Seq after C5orf60 manipulation
- Protein interaction studies
- Phosphoproteomics
- Downstream effectors
- Signaling pathways affected
4. In Vivo ValidationAnimal models- Xenografts with manipulated cell lines
- PDX models
- Treatment response studies
- Tumor growth kinetics
- Metastatic potential
- Therapy resistance
5. Clinical CorrelationTranslational studies- Prospective patient cohorts
- Multivariate analysis with clinical parameters
- Validation of prognostic value
- Potential therapeutic implications

For statistical robustness, each experimental phase should include:

  • Appropriate sample sizes based on power calculations

  • Technical and biological replicates

  • Blinded analysis where applicable

  • Comprehensive controls including non-targeting guides for CRISPR studies

How can researchers address the challenges of studying an uncharacterized protein like C5orf60?

Studying uncharacterized proteins presents unique challenges requiring specialized approaches:

  • Antibody limitations:

    • Generate custom antibodies against synthetic peptides from predicted immunogenic regions

    • Validate antibody specificity using knockout controls

    • Consider epitope-tagged versions for detection if antibodies are problematic

  • Unknown cellular localization:

    • Perform subcellular fractionation followed by Western blotting

    • Use fluorescently-tagged constructs for live-cell imaging

    • Apply density gradient centrifugation for organelle isolation

  • Functional uncertainty:

    • Employ broad phenotypic screens after manipulation

    • Utilize multi-omics approaches to identify affected pathways

    • Apply chemical genomics to identify small-molecule modulators

  • Interaction partner identification:

    • Use unbiased proximity labeling techniques

    • Perform co-immunoprecipitation under various cellular conditions

    • Consider cross-linking approaches to capture transient interactions

  • Validation in physiological context:

    • Generate tissue-specific conditional knockout models

    • Use primary cell cultures rather than established cell lines

    • Correlate experimental findings with clinical observations

By systematically addressing these challenges, researchers can progressively build a functional understanding of C5orf60 and similar uncharacterized proteins.

How should researchers analyze RNA-seq data to understand C5orf60's role in cellular pathways?

When analyzing RNA-seq data to investigate C5orf60's function, implement this analytical pipeline:

  • Experimental Design Considerations:

    • Compare C5orf60 CRISPR-activated or knockout cells with appropriate controls

    • Include multiple timepoints to capture early and late effects

    • Consider different cellular contexts (e.g., normoxia vs. hypoxia)

  • Data Processing Workflow:

    • Quality control with FastQC or similar tools

    • Trim adapters and low-quality reads

    • Align to reference genome using STAR or HISAT2

    • Quantify gene expression with featureCounts or RSEM

    • Normalize counts using DESeq2 or edgeR

  • Differential Expression Analysis:

    • Identify significantly altered genes (typical thresholds: adjusted p-value < 0.05, |log2FC| > 1)

    • Visualize results using volcano plots and heatmaps

    • Validate key findings with RT-qPCR

  • Pathway and Network Analysis:

    • Perform Gene Ontology enrichment analysis

    • Conduct KEGG or Reactome pathway enrichment

    • Utilize gene set enrichment analysis (GSEA)

    • Construct gene regulatory networks

    • Identify transcription factor activity changes

  • Integration with Other Data Types:

    • Correlate with publicly available cervical cancer datasets

    • Integrate with ChIP-seq to identify direct regulatory relationships

    • Combine with proteomics data to assess translation effects

Table 5: Key Bioinformatic Tools for C5orf60 Research

Analysis TypeRecommended ToolsApplication in C5orf60 Research
Differential ExpressionDESeq2, edgeR, limmaIdentify genes affected by C5orf60 manipulation
Pathway AnalysisGSEA, Enrichr, Ingenuity Pathway AnalysisDetermine biological processes influenced by C5orf60
Network AnalysisCytoscape, STRING, GeneMANIAMap interaction networks and regulatory relationships
Visualizationggplot2, ComplexHeatmap, EnhancedVolcanoCreate publication-quality figures
Survival Analysissurvminer, survival (R packages)Correlate gene expression with patient outcomes

How can mass spectrometry data be leveraged to study C5orf60 post-translational modifications?

Post-translational modifications (PTMs) often dictate protein function and can be crucial for understanding uncharacterized proteins like C5orf60:

  • Sample Preparation Strategies:

    • Express and purify C5orf60 using cell-free systems or appropriate cell lines

    • Perform enrichment for specific PTMs:

      • Phosphopeptides: TiO2, IMAC, or phospho-antibody enrichment

      • Glycopeptides: Lectin affinity chromatography

      • Ubiquitinated peptides: Antibody-based enrichment for di-glycine remnants

  • Mass Spectrometry Approaches:

    • Use high-resolution instruments (Orbitrap, Q-TOF)

    • Employ multiple fragmentation techniques:

      • HCD for general PTM identification

      • ETD or EThcD for labile modifications

      • CID for phosphorylation site localization

    • Consider parallel reaction monitoring (PRM) for targeted analysis

  • Data Analysis Workflow:

    • Database search using MaxQuant, MASCOT, or SEQUEST

    • Specify variable modifications based on prediction algorithms

    • Apply appropriate false discovery rate controls

    • Use PTM localization scoring algorithms

    • Consider de novo sequencing for novel modifications

  • Functional Validation:

    • Generate site-directed mutants at identified PTM sites

    • Compare cellular localization and interaction partners

    • Assess impact on protein stability and half-life

    • Determine effects on putative enzymatic activity

For C5orf60, preliminary sequence analysis suggests potential phosphorylation sites in the serine-rich regions and possible ubiquitination sites that could regulate protein turnover.

What are the most promising research directions for C5orf60?

Based on current knowledge and gaps, the following research directions offer the most promising avenues for advancing understanding of C5orf60:

  • Clinical Significance Expansion:

    • Validate prognostic value in larger, prospective cervical cancer cohorts

    • Investigate expression and significance in other cancer types

    • Explore potential as a therapeutic target or biomarker

  • Functional Characterization:

    • Determine subcellular localization and trafficking

    • Identify key interaction partners and complexes

    • Elucidate role in signaling pathways implicated in cancer

  • Structural Biology:

    • Solve 3D structure using X-ray crystallography or cryo-EM

    • Identify functional domains and critical residues

    • Perform structure-based drug design if validated as therapeutic target

  • Regulatory Mechanisms:

    • Characterize transcriptional and post-transcriptional regulation

    • Map essential post-translational modifications

    • Determine protein turnover and degradation pathways

  • Therapeutic Potential:

    • Evaluate as direct therapeutic target using small molecules or biologics

    • Assess as biomarker for patient stratification

    • Investigate synthetic lethality approaches

The initial finding that C5orf60 forms part of a prognostic signature in cervical cancer provides a strong foundation for these research directions, with particular emphasis on validating and extending its clinical significance while simultaneously unraveling its molecular function.

How can researchers contribute to the functional annotation of uncharacterized proteins like C5orf60?

Researchers can make significant contributions to functionally annotating C5orf60 and similar uncharacterized proteins through:

  • Consortium Participation:

    • Join international efforts like the Uncharacterized Protein Consortium

    • Contribute to community databases and knowledge bases

    • Participate in collaborative, multi-laboratory initiatives

  • Methodological Innovation:

    • Develop novel high-throughput functional screening approaches

    • Refine computational prediction algorithms

    • Establish improved protocols for challenging proteins

  • Open Science Practices:

    • Share negative results to prevent duplication of effort

    • Deposit raw data in public repositories

    • Contribute reagents to repositories like Addgene

  • Integration of Multi-omics Data:

    • Combine transcriptomics, proteomics, and metabolomics

    • Apply systems biology approaches to predict function

    • Utilize machine learning for pattern identification

  • Evolutionary Approaches:

    • Perform comparative genomics across species

    • Identify conserved structural or sequence features

    • Study orthologs in model organisms with well-established genetic tools

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.