Recombinant Human Putative uncharacterized protein C8orf49 (C8orf49)

Shipped with Ice Packs
In Stock

Description

Introduction to C8orf49

C8orf49, also known as chromosome 8 open reading frame 49, is a gene that encodes a protein of unknown function . It has also been referred to as G4DM . The protein coded by C8orf49 is named CH049_HUMAN . Studies show that C8orf49 has 197 functional associations with biological entities spanning 6 categories (molecular profile, organism, functional term, phrase or reference, disease, phenotype or trait, cell line, cell type or tissue, gene, protein or microRNA) extracted from 15 datasets .

Gene Information and Functionality

The C8orf49 gene is located on chromosome 8 . It is associated with various functional terms and biological entities, suggesting its involvement in multiple cellular processes .

Table 1: Functional Associations of C8orf49

CategoryDescription
Molecular ProfileCell lines with varying expression levels of C8orf49.
Functional TermTranscription factor binding sites and target genes.
Cellular ComponentCellular components containing the C8orf49 protein.
Tissue ExpressionTissues with high expression of C8orf49 protein.

Role in Disease

Recent studies have indicated a potential role for C8orf49 in certain diseases, specifically in endometriosis (EMs) .

  • Endometriosis: Research has found that the long non-coding RNA (lncRNA) C8orf49 is overexpressed in endometriosis tissues and plasma, influencing dysmenorrhea and the revised American Society for Reproductive Medicine stage of EMs . C8orf49 expression is an independent risk factor for EMs . In endometrial stromal cells, inhibiting C8orf49 can impede proliferation and metastasis, suggesting its role in the pathogenesis of EMs via the C8orf49/miR-1323/PTEN/FZD4 axis .

  • Osteosarcoma: C8orf49, along with FAM99A and FAM87B, have been identified in osteosarcoma studies .

  • Amyotrophic Lateral Sclerosis (ALS) and Frontotemporal Dementia (FTD): C9orf72 is the most common inherited cause of ALS and FTD .

Expression and Localization

C8orf49 expression varies across different tissues and cell lines . This suggests that C8orf49 may have tissue-specific functions.

Interactions

Protein interaction prediction analysis suggests that C11orf96 is associated with transmembrane family proteins and zinc finger proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
C8orf49; Putative uncharacterized protein C8orf49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C8orf49
Target Protein Sequence
MEKPRLYQKYKISRVWWRLPVIPATREAEDNRLNPEGRGCGEPRSRHCTPAWTTTAKLHL KTIISLQPLNMYQMEPGVGSIRTSPALQSPPALTRGPSAWDTAIRKALSFGVGLGVLVLV CLFYHFVTLAPILQFASLPCLLEAGAQMSRHPVTTQVCIMPARLSLGSGISRNLLRLSVC HFTLLLPFRSLRPCPLSSRDMVLSYELWLLCDFYIAPPDSSGSGICKKAI
Uniprot No.

Q&A

What is C8orf49 and why is it classified as a putative uncharacterized protein?

C8orf49 is classified as a putative uncharacterized protein because it was initially identified through genomic sequencing as an open reading frame (ORF) on chromosome 8, but its precise biological function remained unknown at the time of identification . Hypothetical proteins (HPs) like C8orf49 constitute a substantial fraction of proteomes in both prokaryotes and eukaryotes, with their existence predicted based on computational analysis of genomic sequences rather than experimental validation . Recent research has identified C8orf49 as a long non-coding RNA (lncRNA) that plays significant roles in cellular processes, particularly in pathological conditions such as endometriosis .

What are the structural characteristics of C8orf49?

C8orf49 has been characterized as a long non-coding RNA with specific functional domains that enable it to interact with microRNAs, particularly miR-1323 . While comprehensive structural analyses are still emerging, preliminary studies suggest that C8orf49 contains binding sites that facilitate RNA-RNA interactions, enabling its function as a competing endogenous RNA (ceRNA). This structural characteristic allows C8orf49 to sequester microRNAs and prevent them from binding to their target mRNAs, thereby indirectly regulating gene expression . The precise three-dimensional structure remains to be fully elucidated through techniques such as X-ray crystallography or cryo-electron microscopy.

How is C8orf49 expression regulated in normal tissues?

Under normal physiological conditions, C8orf49 shows a tissue-specific expression pattern. While comprehensive expression profiles across all human tissues are still being established, current data indicates that C8orf49 expression is regulated by tissue-specific transcription factors and epigenetic modifications . The expression of C8orf49, like many lncRNAs, can be influenced by:

  • Chromatin accessibility and histone modifications in the promoter region

  • DNA methylation status of regulatory elements

  • Binding of tissue-specific transcription factors

  • Post-transcriptional regulation by RNA-binding proteins

Understanding these regulatory mechanisms is crucial for interpreting aberrant expression patterns observed in pathological conditions .

What are the recommended methods for detecting and quantifying C8orf49 in biological samples?

Several approaches can be employed for detecting and quantifying C8orf49 in biological samples, each with specific advantages depending on research objectives:

TechniqueApplicationsSensitivityAdvantagesLimitations
ELISAProtein quantification in tissue homogenates, cell lysates, and biological fluids0.156-10 ng/mlHigh-throughput, standardized protocolRequires specific antibodies
RT-qPCRmRNA expression analysisCan detect low copy numbersHigh sensitivity, quantitativeRNA quality dependent, primer specificity crucial
RNA-seqTranscriptome-wide expression analysisModerate to highGlobal perspective, novel isoform detectionComplex data analysis, higher cost
Western blotProtein expression verificationModerateSize determination, semi-quantitativeAntibody specificity, labor-intensive
In situ hybridizationTissue localizationModerateSpatial informationTechnical complexity, qualitative

For optimal results, researchers should employ multiple complementary techniques. For example, ELISA kits specific for C8orf49 provide quantitative measurements with a detection range of 0.156-10 ng/ml, making them suitable for precise quantification in various biological samples .

How can researchers address batch effects in expression studies of C8orf49?

  • Experimental design considerations:

    • Balance biological conditions across sequencing lanes and runs

    • Process all samples simultaneously when possible

    • Include technical replicates across different batches

    • Implement proper randomization strategies

  • Statistical approaches for post-hoc correction:

    • Apply established batch correction algorithms (ComBat, RUVSeq, etc.)

    • Incorporate batch as a covariate in statistical models

    • Use principal component analysis to identify and account for batch-associated variation

    • Implement control samples across batches for normalization

What is the role of C8orf49 in endometriosis pathogenesis?

Recent research has identified C8orf49 as a key player in endometriosis (EMs) pathogenesis through the following mechanisms:

  • Expression profile: C8orf49 is stably overexpressed in EMs tissues and plasma compared to controls .

  • Clinical correlation: C8orf49 expression significantly influences dysmenorrhea (p = 2.2605E-9) and the revised American Society for Reproductive Medicine stage of EMs (p = 0.040765) .

  • Statistical significance: Multivariate logistic regression analysis has identified C8orf49 expression as an independent risk factor for EMs [p = 6.4997E-17, 95% confidence interval (CI) = 0.000559-0.023853] .

  • Cellular mechanisms: In primary endometrial stromal cells (ESCs), inhibition of C8orf49 impedes proliferation and metastasis .

  • Molecular pathway: C8orf49 functions through the C8orf49/miR-1323/PTEN/FZD4 axis, influencing cellular behavior and disease progression .

These findings suggest that C8orf49 could serve as both a diagnostic biomarker and a potential therapeutic target for endometriosis, addressing the critical need for early diagnostic markers in this condition where delayed diagnosis often results in delayed intervention .

How does C8orf49 interact with microRNAs to regulate gene expression?

C8orf49 functions as a competing endogenous RNA (ceRNA) that modulates gene expression through specific interactions with microRNAs, particularly miR-1323. The mechanism involves:

  • Sequestration: C8orf49 contains binding sites for miR-1323, effectively "sponging" these microRNAs and preventing them from binding to their target mRNAs .

  • Regulatory cascade: By absorbing miR-1323, C8orf49 influences the expression of downstream targets PTEN and FZD4 .

  • Pathway modulation: This regulatory interaction affects cellular processes including proliferation, migration, and invasion, particularly in the context of endometriosis .

This mechanism exemplifies the complex regulatory networks involving lncRNAs and their roles as modulators of gene expression beyond the traditional central dogma of molecular biology .

What strategies can be employed to functionally annotate uncharacterized domains within C8orf49?

Functional annotation of uncharacterized domains within proteins like C8orf49 requires a multi-faceted approach combining computational prediction with experimental validation:

  • Computational strategies:

    • Homology-based prediction using tools like BLAST and HHpred

    • Structure prediction using AlphaFold2 or RoseTTAFold

    • Domain identification using InterProScan or SMART

    • Protein-protein interaction prediction using STRING

  • Experimental validation approaches:

    • Deletion mutagenesis to identify functional domains

    • CRISPR-Cas9 mediated genome editing to introduce specific mutations

    • RNA immunoprecipitation to identify RNA-binding partners

    • Crosslinking and immunoprecipitation (CLIP) to map RNA-protein interaction sites

  • Integrated workflow:

    • Begin with computational predictions to generate hypotheses

    • Design targeted experiments to test specific domain functions

    • Validate findings across multiple experimental systems

    • Apply systems biology approaches to position findings within biological networks

How can researchers integrate multi-omics data to elucidate C8orf49 function in disease contexts?

Understanding the complex role of C8orf49 in disease contexts requires integration of multiple omics datasets through a structured approach:

  • Data generation across platforms:

    • Genomics: Identify genetic variants affecting C8orf49 expression or function

    • Transcriptomics: Characterize expression patterns in diverse tissues and conditions

    • Proteomics: Quantify protein levels and post-translational modifications

    • Interactomics: Map protein-protein and protein-RNA interactions

    • Epigenomics: Profile chromatin accessibility and histone modifications

  • Computational integration strategies:

    • Network-based approaches to identify functional modules

    • Machine learning algorithms to predict functional relationships

    • Pathway enrichment analysis to position findings in biological context

    • Bayesian integration methods to build causal networks

  • Validation in disease models:

    • Patient-derived samples to confirm clinical relevance

    • Animal models to validate mechanistic hypotheses

    • Cell culture systems for manipulative experiments

A successful example of this approach is seen in the endometriosis study, where researchers integrated transcriptomic data with functional assays in cellular and animal models to establish the C8orf49/miR-1323/PTEN/FZD4 axis as a key pathway in disease pathogenesis .

What are the most effective approaches for identifying potential therapeutic targets within the C8orf49 regulatory network?

Identifying therapeutic targets within the C8orf49 regulatory network requires a systematic approach that balances biological significance with druggability:

  • Network mapping and prioritization:

    • Construct comprehensive protein-protein and RNA-protein interaction networks

    • Identify hub proteins and critical nodes using network analysis algorithms

    • Prioritize targets based on centrality measures and network vulnerability analysis

  • Druggability assessment:

    • Evaluate structural features conducive to small molecule binding

    • Assess availability of binding pockets using computational prediction tools

    • Consider alternative modalities (e.g., antisense oligonucleotides) for challenging targets

  • Validation strategies:

    • Genetic perturbation (siRNA, CRISPR) to confirm target essentiality

    • Small molecule screening to identify lead compounds

    • Structure-based drug design for optimized target engagement

  • Translational considerations:

    • Assess target expression in relevant patient populations

    • Evaluate potential off-target effects through pathway analysis

    • Consider biomarker development for patient stratification

In the context of C8orf49-related conditions like endometriosis, targeting the C8orf49/miR-1323/PTEN/FZD4 axis has shown promise in preclinical models, demonstrating that inhibition of C8orf49 can suppress endometrial growth in animal models .

What are best practices for designing experiments to investigate C8orf49 function in cellular models?

Designing robust experiments to investigate C8orf49 function requires careful consideration of multiple factors:

  • Model system selection:

    • Choose cell lines that endogenously express C8orf49 at detectable levels

    • Consider primary cells for physiological relevance (e.g., primary endometrial stromal cells for endometriosis studies)

    • Select appropriate control cell lines with minimal or no C8orf49 expression

  • Genetic manipulation strategies:

    • RNA interference: siRNA or shRNA for transient or stable knockdown

    • CRISPR-Cas9: For complete knockout or precise genetic modifications

    • Overexpression systems: For gain-of-function studies with appropriate controls

  • Validation approaches:

    • Use multiple independent siRNAs/shRNAs to control for off-target effects

    • Implement rescue experiments to confirm specificity

    • Verify knockdown/overexpression efficiency at both RNA and protein levels

  • Phenotypic assays:

    • Proliferation: MTT/XTT assays, BrdU incorporation, colony formation

    • Migration/invasion: Wound healing, transwell assays

    • Pathway activation: Reporter assays, Western blotting for downstream effectors

  • Controls and replicates:

    • Include both positive and negative controls in all experiments

    • Perform biological replicates (minimum n=3) for statistical robustness

    • Include technical replicates to assess methodological variation

These principles have been successfully applied in studies examining C8orf49's role in endometriosis, where researchers employed siRNA-mediated knockdown in primary endometrial stromal cells followed by comprehensive phenotypic characterization .

How can researchers resolve contradictory findings in C8orf49 research literature?

Resolving contradictory findings is a common challenge in emerging research fields like C8orf49 biology. Researchers can address these contradictions through a structured approach:

  • Methodological assessment:

    • Compare experimental designs, sample sizes, and statistical approaches

    • Evaluate cell types, culture conditions, and genetic backgrounds

    • Assess reagent specificity, particularly antibodies and siRNAs

    • Consider batch effects and technical variations between studies

  • Contextual factors:

    • Examine tissue-specific effects that might explain different outcomes

    • Consider disease stage or cellular state differences

    • Evaluate the impact of microenvironmental factors on experimental outcomes

  • Replication strategies:

    • Conduct independent validation of key findings using multiple approaches

    • Collaborate with original authors to replicate critical experiments

    • Consider preregistered replication studies for particularly controversial findings

  • Meta-analytical approaches:

    • Perform systematic reviews of the literature with predefined criteria

    • Conduct meta-analyses where data quality and quantity permit

    • Use forest plots to visualize effect sizes across studies

A notable example from genomics research highlights the importance of experimental design and replication: reanalysis of data from a study on tissue-specific gene expression revealed that apparent species-specific clustering was due to batch effects rather than biological differences . This emphasizes the need for careful experimental design and critical evaluation of contradictory findings in C8orf49 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.