Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1)

What is CRYM-AS1 and what is its genomic characterization?

CRYM-AS1 (CRYM antisense RNA 1) is a long non-coding RNA that has gained significant attention in recent cancer biology research. It is also known as NCRNA00169 or CRYM antisense gene protein 1 . The protein is 109 amino acids in length with the sequence: MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFA AQPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG . Its genomic location is antisense to the CRYM gene, which encodes mu-crystallin, a protein implicated in normal auditory function . CRYM-AS1 functions primarily through epigenetic regulation mechanisms and has been found to interact with specific protein complexes that influence gene expression patterns .

How does CRYM-AS1 influence cellular metabolism and proliferation?

CRYM-AS1 has been demonstrated to inhibit aerobic glycolysis and cell proliferation in gastric cancer cells . Functional experiments including MTT assays and metabolic profiling (glucose consumption, lactate production, and ATP production) have revealed that CRYM-AS1 overexpression leads to decreased glycolytic activity in cancer cells . This metabolic reprogramming effect is mediated through its interaction with epigenetic regulators, particularly EZH2 (Enhancer of zeste homolog 2), which subsequently affects downstream metabolic pathways . The inhibitory effect on cell proliferation appears to be partially mediated through its regulation of CRYM expression and subsequent alterations in energy metabolism pathways essential for cancer cell survival and growth .

What are the optimal methods for detecting and measuring CRYM-AS1 expression in clinical samples?

For accurate detection and quantification of CRYM-AS1 expression in clinical samples, RT-qPCR remains the gold standard methodology as utilized in recent studies . Sample preparation should include careful isolation of total RNA from tissues or cells, followed by cDNA synthesis using reverse transcription. The selection of appropriate reference genes for normalization is critical, with GAPDH and β-actin commonly used in CRYM-AS1 research . For subcellular localization studies, which are essential given CRYM-AS1's regulatory mechanisms, subcellular fractionation followed by RT-qPCR provides valuable information about its functional compartmentalization . When designing primers for CRYM-AS1 detection, researchers should carefully consider potential sequence overlaps with the CRYM sense transcript to ensure specificity .

What experimental approaches are appropriate for investigating CRYM-AS1's molecular interactions?

To elucidate CRYM-AS1's molecular interactions, several complementary techniques have proven effective. RNA binding protein immunoprecipitation (RIP) assays have successfully demonstrated CRYM-AS1's direct binding to EZH2, a key component of the polycomb repressive complex 2 (PRC2) . Chromatin immunoprecipitation (ChIP) assays are valuable for investigating how CRYM-AS1-protein complexes interact with specific genomic regions, particularly when examining promoter methylation patterns . For intervention studies, siRNA-mediated knockdown approaches have been effectively used to reduce CRYM-AS1 expression in cell models. Lipofectamine-based transfection methods have shown good efficacy for introducing siRNA constructs targeting CRYM-AS1, with verification of knockdown efficiency recommended at 48 hours post-transfection via RT-qPCR .

What cellular models are most appropriate for CRYM-AS1 functional studies?

The selection of appropriate cellular models depends on the specific research question regarding CRYM-AS1. For gastric cancer studies, established gastric cancer cell lines with differential endogenous CRYM-AS1 expression have been used successfully . When investigating vascular mechanisms, human umbilical vein endothelial cells (HUVECs) cultured under high glucose conditions provide a valuable model, particularly for studying CRYM-AS1's role in endothelial dysfunction and apoptosis . For overexpression studies, empty vector controls should be included alongside CRYM-AS1 expression constructs to account for potential vector-related effects . When manipulating CRYM-AS1 levels, researchers should consider both acute and chronic expression changes, as the timing of expression alterations may influence observed phenotypes differently .

What are the epigenetic mechanisms through which CRYM-AS1 regulates target gene expression?

CRYM-AS1 employs sophisticated epigenetic regulatory mechanisms, primarily through its interaction with the polycomb repressive complex 2 (PRC2) component EZH2 . This interaction has been confirmed through RIP assays which demonstrate direct binding between CRYM-AS1 and EZH2 protein . The functional consequence of this interaction is the modulation of histone methylation patterns at specific genomic loci, particularly the CRYM promoter region . Bisulfite sequencing PCR (BSP) assays have revealed that CRYM-AS1 mediates CRYM promoter methylation, resulting in transcriptional repression of CRYM . This forms a regulatory axis where CRYM-AS1 negatively regulates CRYM expression through epigenetic silencing. The specificity of this epigenetic regulation appears to be sequence-dependent, suggesting that CRYM-AS1 may act as a guide RNA to direct EZH2 to specific genomic targets .

How does CRYM-AS1 integrate into signaling networks in pathological conditions?

CRYM-AS1 appears to be integrated into multiple signaling networks with context-dependent effects. In gastric cancer, CRYM-AS1 functions within a broader network affecting cancer cell metabolism, particularly aerobic glycolysis pathways critical for tumor growth . In diabetic erectile dysfunction, CRYM-AS1 has been linked to the Hippo-YAP1 signaling pathway, with reduced CRYM-AS1 expression associated with increased YAP1 activation . KEGG pathway enrichment analysis has identified significant associations between CRYM-AS1 expression patterns and specific signaling networks . The downstream effects of CRYM-AS1 dysregulation include altered expression of apoptosis regulators such as Caspase3, BAX, and Bcl-2, with significant changes in the Bcl-2/BAX ratio observed following CRYM-AS1 manipulation . This suggests that CRYM-AS1 functions as a node within complex cellular signaling networks that regulate cell survival, proliferation, and metabolism under pathological conditions.

What is the significance of CRYM-AS1 protein localization in cellular function?

The subcellular localization of CRYM-AS1 is crucial for its functional activities. Research utilizing subcellular fractionation detection has revealed that CRYM-AS1 predominantly localizes within specific cellular compartments where it can interact with its molecular partners such as EZH2 . While recombinant CRYM-AS1 protein with His-tag expression shows a normal distribution pattern in the cytoplasm, mutations in related proteins like CRYM can lead to aberrant subcellular localization . For instance, mutations at the C-terminus of CRYM (K314T and X315Y) result in perinuclear accumulation and vacuolated cytoplasmic distribution, respectively, which correlate with functional deficits . These findings suggest that proper localization is essential for CRYM-AS1's regulatory functions, and disruptions in localization patterns may contribute to pathological conditions. Researchers investigating CRYM-AS1 should therefore consider subcellular localization as a critical parameter in functional studies.

What therapeutic strategies could target the CRYM-AS1 regulatory axis?

Therapeutic targeting of the CRYM-AS1 regulatory axis represents a promising approach for conditions characterized by CRYM-AS1 dysregulation. For contexts where CRYM-AS1 is downregulated, such as gastric cancer, strategies to restore its expression could include epigenetic modifying agents that influence promoter methylation status of CRYM-AS1 . Alternatively, synthetic CRYM-AS1 mimics could potentially restore the tumor-suppressive functions observed in functional studies . For targeting the downstream effects of CRYM-AS1 dysregulation, inhibitors of the EZH2-mediated epigenetic modifications or modulators of the Hippo-YAP1 pathway could prove beneficial . The development of nucleic acid-based therapeutics, including antisense oligonucleotides or modified RNAs that can stabilize or replace CRYM-AS1 function, represents an active area for translational research. Any therapeutic strategy should consider the tissue-specific expression patterns and functions of CRYM-AS1 to minimize off-target effects.

What are the expression profiles of CRYM-AS1 across different tissue and disease states?

This expression profile data highlights the consistent downregulation of CRYM-AS1 in pathological conditions compared to normal tissues, suggesting its potential role as a protective factor in multiple tissue contexts .

How do CRYM-AS1 interventions affect downstream molecular pathways?

These intervention studies provide insight into the molecular mechanisms through which CRYM-AS1 regulates cell function, highlighting its role in apoptotic and metabolic pathways that are critical for cell survival and proliferation .

What are the key experimental parameters for recombinant CRYM-AS1 protein studies?

These parameters provide essential information for researchers working with recombinant CRYM-AS1 protein, ensuring experimental reproducibility and optimal handling conditions for functional studies .

What are the unresolved questions regarding CRYM-AS1 biology and function?

Despite significant advances in understanding CRYM-AS1, several critical questions remain unanswered. The tissue-specific expression patterns and physiological functions of CRYM-AS1 beyond the currently studied disease contexts require further investigation . The complete spectrum of proteins that interact with CRYM-AS1, beyond EZH2, remains to be fully characterized . Additionally, the potential role of CRYM-AS1 in other cancer types and metabolic disorders needs systematic exploration. The mechanisms through which CRYM-AS1 expression itself is regulated under normal and pathological conditions are not well defined . The three-dimensional structure of CRYM-AS1 and how it influences its functional interactions represents another knowledge gap. Finally, the evolutionary conservation of CRYM-AS1 and its orthologs in model organisms could provide insights into its fundamental biological significance.

What emerging technologies could advance CRYM-AS1 research?

Several cutting-edge technologies hold promise for advancing CRYM-AS1 research. Single-cell RNA sequencing could reveal cell type-specific expression patterns and heterogeneity of CRYM-AS1 expression within tissues . CRISPR-Cas9 genome editing approaches could enable precise manipulation of CRYM-AS1 loci to study its regulation and function in various cellular contexts. RNA structure probing techniques, such as SHAPE-seq or PARIS, could elucidate the secondary structure of CRYM-AS1 and how it influences protein interactions . Advanced imaging approaches, including RNA-FISH combined with super-resolution microscopy, could provide spatial information about CRYM-AS1 localization in living cells. Proximity labeling methods coupled with mass spectrometry could identify the complete CRYM-AS1 interactome beyond currently known partners . Organoid and patient-derived xenograft models would enable the study of CRYM-AS1 function in more physiologically relevant systems than traditional cell cultures.