Recombinant Human Putative uncharacterized protein encoded by LINC00052 (LINC00052)

Shipped with Ice Packs
In Stock

Description

General Information

LINC00052 is a long intergenic non-protein coding RNA that has a role in the tumorigenesis, progression, and metastasis of multiple types of human cancer, including hepatocellular carcinoma and breast cancer . LINC00052 may act as either an oncogene or a tumor suppressor gene, depending on the cancer type .

LINC00052 in Cancer Research

  • Breast Cancer: LINC00052 may promote cancer progression in breast cancer by regulating miR-145-5p and TGFBR2 . LINC00052 expression was found to be upregulated in breast cancer, and it may competitively bind to miR-145-5p to upregulate TGFBR2 expression, thereby serving a key role in promoting breast cancer .

  • Hepatocellular Carcinoma (HCC): LINC00052 inhibits the invasion and migration of HCC cells . LINC00052 may have a tumor suppressor function in HCC and could be a potential target for therapy of HCC . Three target genes of LINC00052 have been identified: Neurotrophic receptor tyrosine kinase 3 (NTRK3), erythrocyte membrane protein band 4.1-like 3 (EPB41L3), and SRY-related HMG-box gene 9 (SOX9) .

    • LINC00052 inhibits cell proliferation, invasion, and migration by upregulating NTRK3 expression through complementary base pairing with microRNA (miRNA/miR)-128 and miR-485-3p .

    • LINC00052 directly acts on EPB41L3 to affect the occurrence and development of HCC by targeting miR-452-5p .

LINC00052 and Acute Kidney Injury

LINC00052 expression was significantly decreased in acute kidney injury (AKI) patient serum . Overexpression of LINC00052 increased hypoxia-induced inhibition of NRK-52E cell proliferation and reversed hypoxia-triggered apoptosis . LINC00052 increases NRK-52E cell proliferation and represses apoptosis by sponging miR-532-3p .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LINC00052; NCRNA00052; TMEM83; Putative uncharacterized protein encoded by LINC00052; Putative transmembrane protein 83
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LINC00052
Target Protein Sequence
MNCDALLHHSAIPEDFLHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSV YVSLSLSSFPCFSLTHTHTHSQLSKDTSVLTFTFCFKQHTHFTLNYTSHAHELSAPSVHP TCVFTFKAAPSPRPAT
Uniprot No.

Target Background

Database Links

HGNC: 26455

UniGene: Hs.350808

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is LINC00052 and how is it classified in the non-coding RNA family?

LINC00052 (Long intergenic non-protein coding RNA 52) is a non-coding RNA that exceeds 200 nucleotides in length, placing it in the long non-coding RNA (lncRNA) category. It belongs specifically to the long intergenic non-coding RNA subclass, indicating that it is located between protein-coding genes rather than overlapping with them . LINC00052 has been identified as a key player in various physiological and pathological processes in the human body, with particularly notable roles in cancer development and progression .

Unlike protein-coding mRNAs, LINC00052 does not contain significant open reading frames that translate into functional proteins, though it may encode putative uncharacterized proteins of currently unknown function. For experimental purposes, researchers typically work with recombinant versions of putative proteins encoded by LINC00052 to investigate their potential roles, if any exist.

What cancer types have been associated with altered LINC00052 expression?

LINC00052 has been implicated in multiple cancer types through expression analysis and functional studies. The current literature demonstrates substantial involvement in:

Notably, LINC00052 appears to have the most thoroughly characterized role in breast cancer, where its expression was identified as significantly downregulated (47-fold decrease after 12 days and 69-fold decrease after 20 days) during three-dimensional culture of breast cancer cells . This marked downregulation suggests LINC00052 may function as a key regulatory element in breast cancer development.

How does LINC00052 expression vary across breast cancer molecular subtypes?

Analysis of TCGA (The Cancer Genome Atlas) data reveals that LINC00052 is overexpressed in samples from all breast cancer molecular subtypes compared to normal breast tissue . A similar expression pattern was confirmed in an independent in-house patient cohort . When examining specific subtypes:

Breast Cancer SubtypeLINC00052 ExpressionNotable Observations
Luminal AOverexpressedMay be influenced by estrogen receptor status
Luminal BOverexpressedMay be influenced by estrogen receptor status
HER2+OverexpressedExpression independent of hormone receptor status
Basal-like/TNBCOverexpressedExpression despite absence of hormone receptors
Normal-likeReference levelUsed for comparison in expression analyses

Methodologically, these analyses were performed using normalized FPKM (fragments per kb per million) values from TCGA data, with log2FC (Fold Change; FC ± 2, p-value < 0.05) calculations to identify differentially expressed genes across subtypes . The bc-GenExMiner v5 online tool was also employed to assess LINC00052 expression using both TCGA and METABRIC datasets .

What laboratory techniques are most effective for measuring LINC00052 expression in clinical samples?

For accurate measurement of LINC00052 expression in clinical samples, several complementary techniques have proven effective:

  • RNA isolation and RT-qPCR: Total RNA extraction using specialized kits (e.g., TRIzol reagent) followed by DNase treatment and cDNA synthesis with High-Capacity Kits represents the gold standard approach . Specific primers targeting LINC00052 and appropriate reference genes (e.g., TBP) are essential for accurate quantification . RT-qPCR provides a cost-effective, sensitive method for LINC00052 quantification in clinical settings.

  • RNA sequencing (RNA-seq): For unbiased transcriptome-wide profiling, RNA-seq can detect LINC00052 along with other transcripts. This approach is particularly valuable for discovering novel relationships between LINC00052 and other genes . Analysis typically involves normalizing to FPKM or TPM values.

  • Microarray analysis: Microarray-based methods remain valuable for targeted expression studies. Analysis of .cel files with Transcriptome Analysis Console (TAC 4.0) software using appropriate statistical parameters (Fold change, p-value ≤0.05, FDR ≤0.05) can reliably detect changes in LINC00052 expression .

For subcellular localization studies, which provide crucial information about potential LINC00052 function, separation of cytoplasmic and nuclear fractions before RNA isolation is recommended . This approach has been instrumental in confirming LINC00052's presence in the cytoplasm, supporting its potential involvement in ceRNA (competing endogenous RNA) regulatory networks .

How can researchers effectively manipulate LINC00052 expression in experimental models?

Several strategies have proven effective for manipulating LINC00052 expression in experimental settings:

  • shRNA-mediated knockdown: Stable cell lines with reduced LINC00052 expression can be established using short hairpin RNAs (shRNAs). This approach involves designing specific shRNAs targeting LINC00052, cloning them into appropriate vectors, transfecting target cells, and selecting stable transfectants with antibiotics such as puromycin (0.6 μg/mL) . Verification of knockdown efficiency should be performed using RT-qPCR with specific primers.

  • siRNA-mediated knockdown: For transient knockdown experiments, small interfering RNAs (siRNAs) provide an alternative approach. Successful LINC00052 knockdown has been achieved using siRNAs (si-1 and si-2) in breast cancer cell lines such as MCF-7 and MDA-MB-231 . This approach is particularly useful for short-term functional studies.

  • Hormone stimulation: In hormone-responsive breast cancer cell lines (MCF-7 and ZR-75-1), estradiol treatment has been shown to increase LINC00052 expression compared to control conditions . This provides a physiologically relevant method for upregulating LINC00052 in specific cellular contexts.

  • Drug selection models: Cisplatin-resistant MCF-7 cells show downregulated LINC00052 expression, suggesting that development of drug-resistant models may provide a system for studying LINC00052 under altered expression conditions .

For in vivo models, Zebrafish embryo xenotransplant models have been successfully employed to study LINC00052 function, offering advantages of rapid development and visualization of cancer cell behavior .

What in silico tools and databases are most valuable for LINC00052 research?

Computational approaches have become essential for comprehensive analysis of LINC00052 function and expression patterns:

Tool/DatabaseApplication in LINC00052 ResearchKey Features
TCGA (The Cancer Genome Atlas)Expression analysis across cancer typesAccess via GDC platform; contains FPKM expression data
cBioPortalMolecular subtype informationEnables grouping of samples by molecular subtypes
KM-plotterSurvival analysisAssesses impact of LINC00052 expression on patient outcomes
bc-GenExMiner v5Expression analysis across subtypesProvides hormone receptor correlation analysis
GSEA (Gene Set Enrichment Analysis)Pathway analysisIdentifies biological processes associated with LINC00052
Key Pathway Advisor (KPA)Pathway analysisVersion 17.4 used for mechanistic insights
RNAInter v4.0Interaction predictionIdentifies molecules potentially associating with LINC00052
KnockTF platformTranscription factor analysisIdentifies putative regulators of LINC00052
starBase v2.0Co-expression analysisExamines relationships with other genes in patient samples

When employing these tools, researchers should consider standardizing analytical parameters. For example, in GSEA analysis, using Phenotype as permutation criteria with default parameters has provided robust results . For differential expression analysis, thresholds of log2FC ± 2 and p-value < 0.05 are commonly applied .

What is the relationship between LINC00052 expression and breast cancer patient survival?

The prognostic significance of LINC00052 stands in contrast to some other lncRNAs like LINC00152 and MIR4435-2HG, which show negative correlations with the tumor-suppressive LINC00261 and are associated with worse outcomes . This distinction highlights the complex and often opposing roles of different lncRNAs in cancer progression.

Methodologically, these survival analyses typically employ Kaplan-Meier curves with log-rank tests for statistical validation. For most robust results, research indicates that analyses should be performed using both default parameters and those restricted to specific molecular subtypes or hormone receptor status .

How does LINC00052 affect breast cancer cell behavior in experimental models?

Experimental manipulation of LINC00052 has revealed several significant effects on breast cancer cell behavior:

  • Cell growth and viability: MCF-7 cells with reduced LINC00052 levels show diminished growth capacity . This finding supports the clinical observation that higher LINC00052 expression correlates with better patient outcomes.

  • DNA damage response: Low LINC00052 expression in MCF-7 cells is associated with increased cellular protection against DNA damage . This suggests LINC00052 may modulate DNA repair pathways, potentially influencing chemotherapy response.

  • Drug resistance: LINC00052 expression is downregulated in cisplatin-resistant MCF-7 cells , indicating possible involvement in mechanisms of chemoresistance development.

  • Migration and invasion: Transwell migration and Matrigel invasion assays in MDA-MB-231 cells have demonstrated that LINC00052 manipulation affects metastatic properties . Specifically, LINC00052 knockdown using siRNAs (si-1 and si-2) altered the cells' ability to migrate and invade through Matrigel matrices .

  • Three-dimensional growth: LINC00052 was identified as the most extensively downregulated lncRNA during three-dimensional culture of breast cancer cells (decreased by 47-fold on day 12 and 69-fold on day 20) . This suggests LINC00052 expression changes significantly during the transition from two-dimensional to three-dimensional growth, potentially reflecting its role in tumor organization.

These findings collectively indicate that LINC00052 affects multiple aspects of breast cancer cell behavior, with experimental evidence pointing toward a potential tumor-suppressive role in accordance with clinical survival data.

What molecular mechanisms mediate LINC00052's effects in breast cancer cells?

Several molecular mechanisms have been proposed to explain LINC00052's functional effects in breast cancer:

  • Estrogen signaling: MCF-7 and ZR-75-1 cells (estrogen receptor-positive) treated with estradiol show increased LINC00052 expression, while this effect is absent in MDA-MB-231 (estrogen receptor-negative) cells . This suggests LINC00052 may be regulated through estrogen receptor signaling pathways, potentially mediating some effects of estrogen in breast cancer.

  • ceRNA network involvement: Analysis of LINC00052's subcellular localization confirms its presence in the cytoplasm, supporting its potential role in competing endogenous RNA (ceRNA) regulatory networks . Specifically, LINC00052 may interact with miR-145-5p, affecting the expression of downstream targets such as TGFBR2 .

  • DNA damage and cell cycle regulation: Bioinformatic analyses indicate that LINC00052 influences DNA damage repair and cell cycle processes . Experimental validation shows that MCF-7 cells with low LINC00052 levels exhibit altered responses to DNA damage .

  • Pathway enrichment analysis: Gene Set Enrichment Analysis (GSEA) comparing LINC00052 expression with KEGG database pathways has identified specific biological processes associated with LINC00052 function . Additionally, Key Pathway Advisor (KPA) analysis has provided insights into mechanistic networks involving LINC00052 .

A potential interaction map derived from RNAInter v4.0 and KnockTF platform analyses suggests LINC00052 may interact with:

Interaction PartnerTypePotential FunctionDetection Method
miR-145-5pmiRNAceRNA regulationBioinformatic prediction, experimental validation
TGFBR2mRNADownstream target in ceRNA networkWestern blot analysis after LINC00052/miRNA manipulation
Estrogen ReceptorTranscription factorRegulation of LINC00052 expressionEstradiol treatment experiments

How does LINC00052 interact with the tumor microenvironment in 3D culture systems?

Three-dimensional culture systems represent a critical advancement in modeling the complex tumor microenvironment. For LINC00052 research, Multicellular Tumor Spheroid (MCTS) models have revealed important insights:

The dramatic downregulation of LINC00052 during MCTS formation (47-fold decrease after 12 days and 69-fold decrease after 20 days) suggests this lncRNA may play a critical role in cell-cell interactions and adaptation to three-dimensional growth conditions. Future research should address:

  • Extracellular Matrix (ECM) interactions: Since MCTS models incorporate ECM elements, researchers should investigate whether LINC00052 mediates cell-ECM interactions through regulation of adhesion molecules or integrin signaling.

  • Hypoxia response: As spheroids develop hypoxic cores, studies should determine if LINC00052 downregulation is triggered by oxygen deprivation or is involved in the cellular adaptation to hypoxic conditions.

  • Cell heterogeneity: Advanced 3D models could explore whether LINC00052 expression varies between different cell populations within the tumor (e.g., proliferating peripheral cells versus quiescent core cells).

Methodologically, establishing MCTS involves seeding one million cells in low-adhesion bottles with L-15 medium supplemented with 5% FBS, under stirring conditions (58 rpm) at 37°C without CO₂ . Medium should be replaced every three days during MCTS growth. Combining this approach with fluorescent labeling and confocal microscopy could provide spatial resolution of LINC00052 expression throughout spheroid development.

What is the potential of LINC00052 as a therapeutic target or biomarker in breast cancer?

  • Prognostic biomarker: Current evidence supports LINC00052's value as a positive prognostic indicator. Future studies should validate this in larger, more diverse patient cohorts and determine if LINC00052 expression adds independent prognostic value beyond established clinical and molecular parameters.

  • Therapeutic target modulation: Since LINC00052 appears to have tumor-suppressive properties, therapeutic approaches might aim to increase its expression. Potential strategies include:

    • Epigenetic modifiers that could reverse silencing of LINC00052

    • Synthetic LINC00052 mimics delivered via nanoparticles

    • Small molecules that stabilize LINC00052 transcripts

  • Chemotherapy response prediction: The observation that LINC00052 is downregulated in cisplatin-resistant MCF-7 cells suggests it may serve as a marker for chemotherapy response. Studies correlating LINC00052 expression with response to various chemotherapeutic agents could help guide treatment selection.

  • Hormone therapy considerations: The estradiol-mediated upregulation of LINC00052 in hormone-responsive breast cancer cells indicates potential interactions with hormone therapy. Research should examine how various endocrine therapies affect LINC00052 expression and whether these changes correlate with treatment efficacy.

A comprehensive approach would involve integrating LINC00052 expression data with other molecular markers to develop multi-parameter prediction models for patient stratification and treatment selection.

How can zebrafish xenograft models advance our understanding of LINC00052 in breast cancer?

Zebrafish embryo xenotransplant models offer unique advantages for studying LINC00052 function in breast cancer:

  • In vivo visualization: Zebrafish embryos are transparent, allowing direct visualization of fluorescently labeled cancer cells and their behavior following manipulation of LINC00052 expression . This enables real-time assessment of processes like invasion, angiogenesis, and metastasis.

  • Rapid development: Zebrafish develop quickly, with experiments typically evaluated at specific days post-fertilization (dpf) . This permits faster experimental turnover compared to mammalian models.

  • Cost-effectiveness: Zebrafish models are more economical than murine models, allowing for higher-throughput screening of LINC00052-targeted interventions.

To effectively implement this model, researchers should:

  • Generate stable breast cancer cell lines with altered LINC00052 expression (knockdown or overexpression) and fluorescent labeling.

  • Optimize injection protocols for delivering cancer cells into appropriate zebrafish anatomical sites (e.g., yolk sac, circulation).

  • Establish quantitative endpoints such as tumor size, dissemination counts, and interaction with host vasculature.

  • Combine with drug treatments to assess how LINC00052 status affects response to various therapeutic agents.

This model is particularly valuable for studying the impact of LINC00052 on metastatic potential, as evidenced by previous observations in zebrafish embryo xenotransplant systems .

What are the current knowledge gaps in LINC00052 research that merit further investigation?

Despite significant advances in understanding LINC00052, several critical knowledge gaps remain:

  • Molecular structure and domains: The structural features of LINC00052 that mediate its functions remain largely undefined. Advanced techniques like SHAPE-MaP (Selective 2'-Hydroxyl Acylation analyzed by Primer Extension and Mutational Profiling) could elucidate secondary structures important for LINC00052's interactions.

  • Comprehensive interactome: While some interaction partners have been identified (e.g., miR-145-5p) , a comprehensive map of LINC00052's protein, RNA, and DNA interactions across different cellular contexts would provide deeper mechanistic insights.

  • Tissue-specific roles: Though breast cancer has been a focus of LINC00052 research, its functions in other cancer types and normal tissues require further exploration. Comparative studies across tissue types could reveal context-dependent functions.

  • Regulation of LINC00052 expression: Beyond estrogen regulation , the transcriptional, post-transcriptional, and epigenetic factors controlling LINC00052 expression remain poorly characterized.

  • In vivo significance: While zebrafish models have been employed , studies using mammalian models with genetic manipulation of LINC00052 would provide more translatable insights into its physiological and pathological roles.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, molecular genetics, systems biology, and translational research. Priority should be given to studies that connect mechanistic findings with clinical observations to enhance the potential therapeutic applications of LINC00052 research.

What emerging technologies might accelerate LINC00052 research in the coming years?

Several cutting-edge technologies show promise for advancing LINC00052 research:

  • Single-cell RNA sequencing: This technology could reveal cell-to-cell variability in LINC00052 expression within heterogeneous tumors and identify specific cell populations where LINC00052 plays critical roles.

  • CRISPR-Cas systems: Beyond traditional gene knockout, CRISPR-based approaches like CRISPRa (activation) and CRISPRi (interference) allow precise modulation of LINC00052 expression. CRISPR screens could also identify genes that synthetically interact with LINC00052.

  • Spatial transcriptomics: These methods provide spatial context to gene expression data, potentially revealing localized LINC00052 expression patterns within tumors and their microenvironment.

  • RNA-protein interaction mapping: Enhanced CLIP-seq (Crosslinking and Immunoprecipitation followed by sequencing) technologies could comprehensively identify proteins interacting with LINC00052 in various cellular contexts.

  • Organoid models: Patient-derived organoids could provide more physiologically relevant systems for studying LINC00052 function compared to traditional cell lines.

  • Artificial intelligence approaches: Machine learning algorithms could help integrate diverse datasets (genomic, transcriptomic, clinical) to identify novel patterns and generate testable hypotheses about LINC00052 function.

Implementing these technologies will require collaborative efforts between computational biologists, molecular biologists, and clinicians to translate technological advances into meaningful insights about LINC00052's role in cancer biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.