Recombinant Human Putative uncharacterized protein encoded by LINC00116 (LINC00116)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Putative uncharacterized protein encoded by LINC00116, also known as Mitoregulin (Mtln), is a small protein associated with mitochondrial function . Initially misannotated as a long non-coding RNA, LINC00116 has been identified as encoding a functional peptide with roles in respiration, lipid metabolism, and possibly tumorigenesis .

Discovery and Characterization

The identification of LINC00116 as a protein-coding gene emerged from conservation analysis, which revealed a highly conserved open reading frame (ORF) of 56 amino acids . This region is conserved among vertebrates, suggesting functional importance . Analysis of nucleotide substitutions in the Mtln coding region indicates that most changes result in similar amino acids, further supporting its functional relevance .

Structure and Localization

Mtln features a hydrophobic region at its N-terminus, likely serving as a transmembrane segment, and a positively charged C-terminus potentially involved in functional interactions . While studies agree that Mtln is associated with the mitochondrial membrane, there are conflicting reports regarding its precise location, with some suggesting the inner mitochondrial membrane (IMM) and others the outer mitochondrial membrane (OMM) . A study using digitonin concentrations and a split-GFP system indicated that Mtln resides in the OMM, with its N-terminus facing the intermembrane space .

Function

Mtln's functions are diverse and somewhat controversial, with several independent research groups supporting different aspects of its activity .

  • Mitochondrial Respiration: Mtln is involved in mitochondrial respiration, specifically impacting the activity of respiratory chain complex I . Inactivation of the Mtln coding gene leads to a reduction in oxygen consumption .

  • Lipid Metabolism: Mtln regulates fatty acid metabolism by interacting with proteins like CPT1B, the rate-limiting enzyme of fatty acid oxidation .

  • RNA Function: The LINC00116 RNA can function independently of its coding potential, acting as a long intergenic non-coding RNA (lincRNA) . It binds to PCBP2, enhancing its ability to repress p53 translation, and can act as a sponge for miR-106a, influencing c-Jun expression .

  • Nuclear Interactions: Mtln has been observed to bind to c-Jun and Nat14 in the nucleus, potentially activating fibrotic gene promoters .

Proteogenomic Integration

Proteogenomic strategies have been employed to identify and validate mitochondrial-localized small proteins, including Mtln . These methods combine database searches with de novo peptide sequencing to identify non-canonical peptides, expanding the potential targets for cancer vaccines and T cell-based immunotherapy .

Interaction with CPT1B

Mtln interacts with CPT1B, a key enzyme in fatty acid oxidation . This interaction suggests a role for Mtln in regulating fatty acid metabolism within the mitochondria .

Table: Key Features of Mitoregulin (Mtln)

FeatureDescription
GeneLINC00116
Alternative NameMitoregulin (Mtln)
Size56 amino acids
LocalizationMitochondria (OMM or IMM)
FunctionRegulates mitochondrial complex assembly and stability , influences respiration and lipid metabolism , binds to PCBP2 to repress p53 translation , interacts with CPT1B to regulate fatty acid oxidation
ConservationConserved among vertebrates
RNA FunctionFunctions as a lincRNA, binding to PCBP2 and acting as a sponge for miR-106a
Potential ApplicationsTarget for cancer vaccines and T cell-based immunotherapy

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate your preferred format in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MTLN; LEMP; LINC00116; MOXI; MPM; NCRNA00116; SMIM37; Mitoregulin; Micropeptide in mitochondria; Micropeptide regulator of beta-oxidation; Small integral membrane protein 37; lncRNA-encoded micropeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM37
Target Protein Sequence
MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPP LNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWR KRRLQDKLAATQKKLDLA
Uniprot No.

Target Background

Function

This protein positively regulates mitochondrial complex assembly and/or stability. It increases mitochondrial membrane potential while decreasing reactive oxygen species production, and enhances mitochondrial respiration rate. This increased respiratory activity promotes myogenic differentiation, facilitating muscle growth and regeneration. Furthermore, it increases mitochondrial calcium retention capacity and plays a role in maintaining cellular lipid composition through interaction with cytochrome b5 reductase (CYB5R3), which is essential for mitochondrial respiratory complex I activity. It interacts with the mitochondrial trifunctional enzyme (MTE) complex, enhancing fatty acid beta-oxidation, although it's not required for MTE formation or stability. Finally, it modulates triglyceride clearance in adipocytes by regulating fatty acid beta-oxidation and lipolysis.

Database Links

HGNC: 27339

UniGene: Hs.128499

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is LINC00116 and what protein does it encode?

LINC00116 was initially classified as a long non-coding RNA but has been demonstrated to encode a highly conserved single-pass transmembrane microprotein called mitoregulin (Mtln). This represents an important reclassification, as LINC00116 contains a small open reading frame (sORF) that is translated by ribosomes, evident through ribosomal profiling data. The encoded protein is approximately 10 kDa in size and features a conserved transmembrane domain that has been predicted across multiple species using PHOBIUS and TMHMM algorithms . This finding challenges the traditional classification of LINC00116 as a non-coding RNA and places it within the growing category of lncRNA-encoded microproteins that have biological functions.

What is the tissue distribution pattern of LINC00116 expression?

LINC00116 RNA demonstrates a tissue-specific expression pattern, with highest expression in skeletal muscle followed by cardiac tissue. Analysis of four independent human RNA-seq body-map datasets shows a consistent enrichment pattern. When examining the encoded protein using western blot analysis with custom antibodies targeting the C-terminal region, the 10 kDa protein is ubiquitously present but particularly enriched in cardiac and skeletal muscle tissues, as well as adipose tissues . This tissue-specific enrichment pattern suggests potential specialized functions in metabolically active tissues with high mitochondrial content.

What are the subcellular localization and function of the protein encoded by LINC00116?

The LINC00116-encoded protein mitoregulin (Mtln) localizes to the inner mitochondrial membrane where it appears to interact with multiple protein complexes involved in cellular respiration. Functionally, Mtln influences:

  • Mitochondrial membrane potential

  • Respiratory efficiency

  • Reactive oxygen species (ROS) production

  • Calcium retention capacity

RNA co-expression analysis reveals that LINC00116 is highly co-expressed with genes involved in mitochondrial functions, particularly those related to respiratory chain complexes and mitochondrial ribosomes. Among the top co-expressed genes, 34 have reported functions specifically related to mitochondrial complex and supercomplex assembly . This strongly suggests that Mtln plays a role in regulating mitochondrial energy production.

What methods can be used to detect and quantify LINC00116 expression in tissue samples?

For researchers interested in analyzing LINC00116 expression in tissue samples, several complementary techniques can be employed:

  • Quantitative Reverse Transcription-PCR (qRT-PCR): This method was successfully used in studies examining expression levels in paired lung cancer and non-cancerous adjacent tissues . Design primers specific to the LINC00116 transcript sequence, ensuring they span exon-exon junctions to avoid genomic DNA amplification.

  • Microarray Analysis: Public databases such as Oncomine and Cancer Cell Line Encyclopedia (CCLE) have been utilized to analyze LINC00116 expression across different cancer types and cell lines . Researchers can leverage these resources for comparative analysis.

  • RNA-Sequencing: For comprehensive transcriptomic profiling, RNA-seq provides unbiased quantification of LINC00116 along with other transcripts. This approach has been used in multiple body-map datasets to establish tissue-specific expression patterns .

  • Western Blot Analysis: To detect the encoded protein, custom antibodies targeting the C-terminal region of mitoregulin have been successfully employed. This technique allows visualization of the 10 kDa protein in tissue lysates and can confirm knockout models when the protein band is absent .

For optimal results, researchers should employ both RNA-level (qRT-PCR or RNA-seq) and protein-level (western blot) detection methods to comprehensively characterize expression patterns.

How can LINC00116 knockout models be generated for functional studies?

Generating LINC00116 knockout models is essential for investigating its biological functions. Based on published methodologies, researchers can employ CRISPR/Cas9 technology to delete the small open reading frame (sORF) from the LINC00116 locus. This approach has been successfully implemented to produce both knockout cells and mice by targeting the homologous mouse locus (1500011K16Rik) .

The knockout strategy should:

  • Design guide RNAs targeting sequences flanking the sORF region

  • Transfect cells with CRISPR/Cas9 components and appropriate selection markers

  • Screen clones for successful deletion using PCR genotyping

  • Confirm knockout at the protein level using western blot analysis (absence of the 10 kDa band)

  • For mice models, implement embryonic stem cell modification or direct zygote injection followed by breeding to establish stable knockout lines

Importantly, researchers should confirm knockout efficiency at both genomic (PCR), transcriptomic (RT-PCR), and proteomic (western blot) levels to ensure complete ablation of mitoregulin expression .

What experimental approaches can determine if LINC00116 serves as a prognostic biomarker in cancer?

To evaluate LINC00116 as a potential cancer prognostic biomarker, researchers should design studies that correlate expression levels with clinical outcomes. A comprehensive approach includes:

How does the mitochondrial function of mitoregulin (encoded by LINC00116) affect cellular metabolism and disease?

The protein encoded by LINC00116, mitoregulin (Mtln), appears to be a key regulator of mitochondrial function through its localization to the inner mitochondrial membrane. Advanced research into its metabolic effects should investigate:

  • Respiratory Complex Interactions: Mtln potentially modulates the assembly and stability of respiratory complexes and supercomplexes involved in:

    • Fatty acid oxidation (FAO)

    • TCA cycle

    • Electron transport chain

  • Calcium Homeostasis: Mtln influences mitochondrial calcium retention capacity, suggesting a role in calcium-dependent metabolic signaling and cell death pathways.

  • Oxidative Stress Regulation: Changes in Mtln levels impact reactive oxygen species (ROS) production, indicating involvement in oxidative stress responses.

Methodologically, researchers should apply:

  • Seahorse XF analysis to measure oxygen consumption rate and extracellular acidification rate

  • Fluorescent probes to monitor mitochondrial membrane potential and ROS production

  • Calcium imaging techniques to assess mitochondrial calcium dynamics

  • Blue native PAGE to evaluate respiratory complex assembly and stability

  • Metabolomics profiling to identify changes in metabolic pathways

Gene co-expression analysis reveals that LINC00116 is highly correlated with numerous mitochondrial genes, with 34 of 85 shared co-expressed genes between human and mouse having reported functions specifically related to mitochondrial complex and supercomplex assembly . This suggests that investigating Mtln in the context of diseases with mitochondrial dysfunction components (neurodegenerative disorders, metabolic diseases, aging) may yield valuable insights.

What methodologies can resolve contradictions between LINC00116's classification as a lncRNA versus a protein-coding gene?

The evolving understanding of LINC00116 exemplifies a broader challenge in genomics: distinguishing true non-coding RNAs from those encoding functional microproteins. To address this classification contradiction, researchers should employ a multi-faceted approach:

  • Ribosome Profiling (Ribo-seq): This technique maps the positions of ribosomes on mRNAs at nucleotide resolution, revealing active translation. When analyzing LINC00116, Ribo-seq data from the GWIPS-viz database indicates the presence of a highly conserved sORF that is actively translated by ribosomes .

  • Evolutionary Conservation Analysis: Comparative genomics using algorithms like PRALINE can assess conservation of the putative open reading frame across species. The high conservation of the LINC00116-encoded microprotein sequence, particularly in the transmembrane domain region, strongly supports its protein-coding function .

  • Mass Spectrometry (MS): Direct detection of the encoded protein through MS validates translation. Custom database searches that include predicted products from putative ORFs in annotated lncRNAs are essential, as standard protein databases often exclude these sequences.

  • Antibody Generation and Validation: Development of specific antibodies against the predicted protein, followed by western blot analysis in wild-type versus knockout tissues, provides definitive evidence of translation. This approach successfully detected the 10 kDa mitoregulin protein and confirmed its absence in knockout models .

  • Functional Characterization: Demonstrating that the protein product has biological activity provides further evidence for protein-coding classification. For LINC00116, the encoded protein influences mitochondrial functions including membrane potential, respiration, ROS production, and calcium retention.

This integrated approach helps resolve the contradiction between RNA-centric and protein-centric classifications, contributing to the growing recognition of lncRNA-ORFs as an important category in genomics .

How can researchers optimize experimental design for causal inference when studying LINC00116 function?

When designing experiments to establish causal relationships between LINC00116/mitoregulin and biological outcomes, researchers should apply rigorous experimental design principles through an optimization lens. Key methodological considerations include:

  • Intervention Selection and Randomization:

    • Implement multiple independent methods to manipulate LINC00116 expression (CRISPR knockout, RNA interference, overexpression)

    • Randomly assign subjects/cells to treatment groups to minimize selection bias

    • Use appropriate controls, including non-targeting controls and rescue experiments

  • Sample Size Optimization:

    • Conduct power analyses to determine adequate sample sizes for detecting biologically meaningful effects

    • Consider effect size estimates from preliminary data

    • Account for expected variability in the measured outcomes

  • Outcome Measurement Strategy:

    • Define primary and secondary endpoints before conducting experiments

    • Use multiple complementary assays to measure outcomes (e.g., different methods to assess mitochondrial function)

    • Implement blinded assessment of outcomes when possible

  • Statistical Analysis Plan:

    • Pre-specify statistical methods for analyzing experimental data

    • Account for multiple testing through appropriate corrections

    • Consider potential confounding variables and include them in analysis models

  • Validation Across Models:

    • Test effects in multiple cell types or tissues

    • Validate in vivo findings using different animal models

    • Confirm relevance to human biology using patient samples or human cell models

This approach aligns with the optimization perspective on experimental design for causal inference, which views experimental design as a decision-making problem requiring careful consideration of trade-offs between efficiency, cost, and inferential validity .

How might LINC00116 expression analysis be incorporated into clinical cancer management?

LINC00116 has demonstrated potential as a prognostic biomarker in lung cancer, with upregulation associated with poorer survival outcomes . Translating this finding into clinical applications requires:

  • Standardized Detection Protocol Development:

    • Establish reproducible qRT-PCR assays with validated reference genes

    • Define threshold expression levels that correlate with clinical outcomes

    • Validate assays across multiple patient cohorts and laboratory settings

  • Integration with Existing Biomarker Panels:

    • Assess whether LINC00116 provides additional prognostic information beyond standard markers

    • Develop multivariate models incorporating LINC00116 with established biomarkers

    • Calculate risk scores that can guide clinical decision-making

  • Prospective Clinical Validation:

    • Design prospective studies to validate the prognostic value of LINC00116

    • Stratify patients based on expression levels and monitor outcomes

    • Assess utility in predicting response to specific therapies

  • Tissue Source Optimization:

    • Determine whether circulating LINC00116 in blood/plasma correlates with tissue expression

    • Evaluate the feasibility of liquid biopsy approaches for less invasive monitoring

    • Compare expression in primary tumors versus metastatic lesions

Research indicates that LINC00116 expression correlates with several clinicopathological features including pT factor, pN factor, pTNM stage, smoking history, differentiation, and Ki-67 labeling index (p < 0.05) . This suggests potential utility in refining risk stratification and potentially guiding treatment decisions for cancer patients.

What approaches can be used to target LINC00116 or its encoded protein therapeutically?

Developing therapeutic strategies targeting LINC00116 or its encoded protein mitoregulin requires consideration of various molecular intervention approaches:

  • RNA-Targeting Strategies:

    • Antisense oligonucleotides (ASOs) designed to bind LINC00116 and prevent translation

    • siRNA/shRNA-mediated knockdown of LINC00116 transcript

    • CRISPR interference (CRISPRi) to suppress transcription of the LINC00116 gene

  • Protein-Targeting Approaches:

    • Small molecule inhibitors that disrupt mitoregulin's interaction with mitochondrial binding partners

    • Peptidomimetics that compete for binding sites on the inner mitochondrial membrane

    • Antibody-based therapies if any portion of mitoregulin is exposed to the cytosol

  • Delivery System Development:

    • Lipid nanoparticles optimized for delivery to target tissues (e.g., lung cancer cells)

    • Cell-penetrating peptides conjugated to RNA-targeting molecules

    • Mitochondria-targeting moieties for protein-level interventions

  • Combination Therapy Strategies:

    • Identify synergistic interactions between LINC00116 inhibition and standard chemotherapies

    • Explore combinations with mitochondrial-targeting agents

    • Test with immune checkpoint inhibitors in relevant cancer models

The therapeutic development process should include validation in both in vitro and in vivo models, with careful attention to off-target effects given mitoregulin's role in normal mitochondrial function. Since LINC00116 is upregulated in lung cancer tissues and correlates with poor survival , initial therapeutic development might focus on cancer applications, particularly in cases where mitochondrial function supports tumor growth and metastasis.

What are the optimal conditions for expressing and purifying recombinant mitoregulin protein?

Based on established protocols for similar single-pass transmembrane proteins and microproteins, researchers seeking to produce recombinant mitoregulin should consider the following methodological approach:

  • Expression System Selection:

    • E. coli-based systems have proven successful for other small proteins with similar characteristics

    • Consider using bacterial strains optimized for membrane protein expression (e.g., C41/C43)

    • For eukaryotic post-translational modifications, insect or mammalian cell systems may be preferable

  • Construct Design:

    • Include affinity tags (His, GST, or MBP) preferably at the N-terminus to avoid interference with C-terminal functional regions

    • Consider fusion partners that enhance solubility if aggregation occurs

    • Include a precision protease cleavage site to remove tags after purification

  • Extraction and Solubilization:

    • Test multiple detergents for optimal membrane protein extraction (DDM, LDAO, Triton X-100)

    • Consider bicelle or nanodisc systems for maintaining native-like membrane environment

    • Evaluate different buffer compositions to enhance stability

  • Purification Protocol:

    • Implement a multi-step purification strategy:

      • Initial capture via affinity chromatography

      • Secondary purification via size exclusion chromatography

      • Consider ion exchange chromatography if needed for higher purity

  • Quality Control Assessment:

    • Verify size and purity via SDS-PAGE and western blotting

    • Confirm identity via mass spectrometry

    • Assess structural integrity through circular dichroism

    • Validate functional activity through appropriate mitochondrial assays

The purification protocol should be optimized to ensure that the recombinant protein maintains its native conformation and functionality, particularly the ability to associate with membranes and interact with binding partners.

What analytical methods can determine the interaction partners of mitoregulin in mitochondria?

To comprehensively identify and characterize the interaction partners of mitoregulin within mitochondrial membranes, researchers should employ multiple complementary approaches:

  • Proximity-Based Labeling Techniques:

    • BioID or TurboID fusion constructs with mitoregulin to biotinylate neighboring proteins

    • APEX2 fusion for proximal protein labeling through peroxidase activity

    • Analyze labeled proteins by mass spectrometry after streptavidin pulldown

  • Co-Immunoprecipitation Strategies:

    • Develop antibodies against native mitoregulin or use tag-based approaches

    • Optimize mild solubilization conditions to preserve protein-protein interactions

    • Implement crosslinking prior to extraction for transient interactions

    • Analyze precipitated complexes using mass spectrometry

  • Blue Native PAGE Analysis:

    • Extract mitochondrial protein complexes under native conditions

    • Compare complex formation and stability between wild-type and knockout samples

    • Perform second-dimension SDS-PAGE to identify components of complexes

  • Fluorescence-Based Interaction Studies:

    • Implement FRET (Förster Resonance Energy Transfer) to study direct interactions

    • Use split-GFP complementation assays for candidate interaction testing

    • Apply FLIM (Fluorescence Lifetime Imaging Microscopy) for quantitative interaction analysis

  • Computational Prediction Validation:

    • Utilize gene co-expression networks to predict potential interaction partners

    • Test top candidates from the 34 co-expressed genes with reported functions in mitochondrial complex assembly

    • Validate predictions using the experimental methods described above

These methods should be applied to both cell culture models and tissue samples when possible, with appropriate controls including knockout systems to distinguish specific from non-specific interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.