Recombinant Human Putative uncharacterized protein FLJ37107

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Target Protein Sequence
MFLGLVGLRTKGRRWISSWSEGEDRGQSPEGVLLTWVFGTKCVMHPCEETTKQALCEQQG CLFHLGADELSPKRESAQSISFKWENSIYLHATLFLIGEYLHLAFYYFLLVLYILCSFLS YCLLLWLGSFL
Uniprot No.

Q&A

What is Recombinant Human Putative Uncharacterized Protein FLJ37107?

Recombinant Human Putative uncharacterized protein FLJ37107 is a 131 amino acid protein identified through genomic sequencing with UniProt ID Q8N9I1. As recombinant protein, it is typically expressed in bacterial systems with an N-terminal His-tag for purification purposes. The protein is currently classified as "uncharacterized," indicating its biological function remains largely unknown and presents an opportunity for novel research discovery .

When working with uncharacterized proteins, researchers should approach them as potential participants in any biological pathway. Initial characterization typically involves sequence analysis, structural prediction, expression pattern analysis, and preliminary functional assays based on predicted domains.

How is the recombinant version of this protein typically produced?

The recombinant FLJ37107 protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. This approach enables relatively high protein yields while maintaining cost-effectiveness for research purposes. The bacterial expression system may lack some post-translational modifications that would be present in mammalian cells, which should be considered when designing experiments .

For researchers investigating this protein, it's important to note that alternative expression systems (mammalian, insect, or cell-free) might provide different structural or functional characteristics, especially if post-translational modifications are suspected to play a role in the protein's function.

What is the recommended protocol for reconstituting lyophilized FLJ37107?

The recommended reconstitution protocol for lyophilized FLJ37107 involves:

  • Centrifuging the vial briefly to ensure all powder is at the bottom

  • Reconstituting in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Adding glycerol to a final concentration of 5-50% (50% is the standard recommendation)

  • Aliquoting the solution for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

This method helps maintain protein stability and activity. When reconstituting any recombinant protein, it's crucial to avoid vigorous shaking or vortexing, which can cause protein denaturation. Gentle pipetting is recommended until the protein is fully dissolved .

What analytical techniques should be employed to validate recombinant FLJ37107 quality?

Multiple analytical techniques should be employed to validate the quality of recombinant FLJ37107:

  • SDS-PAGE to confirm molecular weight and initial purity assessment

  • Western blotting using anti-His antibodies to verify expression of the full-length His-tagged protein

  • Mass spectrometry for precise molecular weight determination and identification of any modifications

  • Size exclusion chromatography to assess aggregation state and homogeneity

  • Circular dichroism to evaluate secondary structure formation

  • Dynamic light scattering to analyze size distribution and potential aggregation

For uncharacterized proteins, comparing experimental results with theoretical predictions from sequence analysis provides valuable validation information. Documentation of multiple quality control parameters establishes a foundation for reproducible experimental findings .

How should researchers design stability studies for FLJ37107?

When designing stability studies for FLJ37107, researchers should consider:

  • Temperature stability: Test protein integrity after storage at different temperatures (-80°C, -20°C, 4°C, and room temperature) over various time points (24 hours, 1 week, 1 month)

  • pH stability: Evaluate protein in buffers ranging from pH 5.0 to 9.0 to determine optimal range for maintaining activity

  • Buffer composition effects: Test various buffering agents (Tris, phosphate, HEPES) and additives (glycerol, reducing agents, salt concentrations)

  • Freeze-thaw stability: Assess protein integrity after multiple freeze-thaw cycles using SDS-PAGE and activity assays

  • Long-term storage conditions: Compare lyophilized versus solution storage

For uncharacterized proteins like FLJ37107, stability studies are particularly important as they provide foundational information for all subsequent functional characterization experiments. Tracking changes in both structural integrity (via SDS-PAGE) and functional activities is essential for comprehensive stability assessment.

What bioinformatic approaches can predict potential functions of FLJ37107?

Multiple bioinformatic approaches should be employed to predict potential functions of FLJ37107:

  • Sequence homology analysis: Employ BLAST, HMMER, and PSI-BLAST to identify similar proteins with known functions

  • Domain prediction: Use tools like SMART, Pfam, and PROSITE to identify functional domains or motifs

  • Gene Ontology enrichment: Analyze GO terms associated with proteins showing sequence similarity

  • Protein-protein interaction prediction: Apply STRING, STITCH or BioGRID to predict potential interaction partners

  • Structural modeling: Use I-TASSER, Phyre2, or AlphaFold2 to predict tertiary structure and functional sites

  • Phylogenetic analysis: Construct evolutionary trees to identify conservation patterns across species

  • Expression correlation analysis: Analyze public transcriptomic datasets to identify genes with correlated expression patterns

The combined results from these approaches can generate testable hypotheses about FLJ37107 function. For instance, the presence of hydrophobic regions in the amino acid sequence suggests potential membrane association, which could be further investigated with more specific predictive tools for transmembrane domains or membrane localization signals .

How can researchers design experiments to elucidate the cellular localization of FLJ37107?

To determine cellular localization of FLJ37107, researchers should employ multiple complementary techniques:

  • Fluorescent fusion protein approach:

    • Create N- and C-terminal GFP or mCherry fusion constructs

    • Express in relevant cell lines and visualize using confocal microscopy

    • Co-localize with established organelle markers (mitochondria, ER, Golgi, etc.)

  • Subcellular fractionation:

    • Separate cellular components (membrane, cytosol, nucleus, etc.)

    • Detect FLJ37107 in fractions using Western blotting

    • Compare distribution with known marker proteins for each fraction

  • Immunofluorescence microscopy:

    • Generate specific antibodies against FLJ37107

    • Perform immunostaining in fixed cells

    • Use super-resolution microscopy for detailed localization

  • Proximity labeling methods:

    • Create BioID or APEX2 fusion constructs with FLJ37107

    • Identify neighboring proteins through mass spectrometry

    • Infer localization from known locations of proximal proteins

When working with uncharacterized proteins, it's crucial to use multiple approaches as each method has inherent limitations. Additionally, testing localization in multiple cell types can reveal cell-specific variations in protein distribution that may provide functional insights.

What experimental approaches are recommended for identifying potential interaction partners of FLJ37107?

To identify potential interaction partners of FLJ37107, researchers should consider implementing these methodologies:

  • Affinity purification-mass spectrometry (AP-MS):

    • Use His-tagged FLJ37107 as bait protein

    • Perform pull-down experiments from cell lysates

    • Identify co-purifying proteins using mass spectrometry

    • Validate with reciprocal pull-downs

  • Yeast two-hybrid screening:

    • Use FLJ37107 as bait against human cDNA libraries

    • Screen for positive interactions using reporter gene activation

    • Validate with secondary assays such as co-immunoprecipitation

  • Proximity-dependent biotinylation (BioID/TurboID):

    • Express FLJ37107 fused to a biotin ligase

    • Identify proximal proteins that become biotinylated

    • Analyze biotinylated proteins by mass spectrometry

  • Cross-linking mass spectrometry:

    • Use chemical crosslinkers to capture transient interactions

    • Identify crosslinked peptides by specialized mass spectrometry approaches

    • Map interaction interfaces at amino acid resolution

  • Co-localization studies:

    • Fluorescently tag FLJ37107 and suspected partners

    • Analyze co-localization using confocal microscopy

    • Quantify using Pearson's correlation coefficient

When investigating uncharacterized proteins like FLJ37107, it's particularly important to include appropriate controls to distinguish specific interactions from background. Performing experiments under different conditions (cell types, stressors, differentiation states) can reveal context-dependent interactions that provide functional insights.

What cell-based assays are recommended for investigating potential functions of FLJ37107?

For investigating potential functions of uncharacterized proteins like FLJ37107, researchers should consider multiple cell-based approaches:

  • Gene silencing/knockout studies:

    • Use siRNA, shRNA, or CRISPR-Cas9 to reduce or eliminate FLJ37107 expression

    • Assess effects on cell morphology, proliferation, migration, and survival

    • Perform RNA-seq to identify affected pathways

  • Overexpression studies:

    • Create stable or inducible cell lines expressing FLJ37107

    • Analyze phenotypic changes compared to control cells

    • Examine effects on known signaling pathways using reporter assays

  • Cellular stress response:

    • Subject FLJ37107-modified cells to various stressors (oxidative stress, nutrient deprivation, etc.)

    • Assess changes in sensitivity compared to control cells

    • Identify stress conditions where FLJ37107 becomes particularly important

  • Differentiation assays:

    • Examine the role of FLJ37107 during cellular differentiation processes

    • Monitor expression changes during differentiation timecourses

    • Assess impact of FLJ37107 modulation on differentiation markers

  • Cell fractionation with activity assays:

    • Isolate subcellular fractions containing FLJ37107

    • Test for enzymatic activities based on bioinformatic predictions

    • Compare activity with and without recombinant FLJ37107 supplementation

For uncharacterized proteins, it's recommended to start with broad phenotypic assays before narrowing to more specific functional tests based on initial findings. Since the hydrophobic regions in FLJ37107 suggest potential membrane association, assays examining membrane integrity or transport functions might be particularly revealing .

How can researchers address potential experimental artifacts when working with recombinant FLJ37107?

When working with recombinant versions of uncharacterized proteins like FLJ37107, researchers should implement these strategies to minimize artifacts:

  • Tag interference assessment:

    • Compare N-terminal versus C-terminal tagged versions

    • Include tag-only controls in all experiments

    • Consider using cleavable tags to remove them after purification

    • Validate key findings with untagged protein when possible

  • Expression system considerations:

    • Compare E. coli-expressed protein with mammalian-expressed versions

    • Assess glycosylation state using glycosidase treatments

    • Check for proper disulfide bond formation in bacterial expressions

  • Contamination control:

    • Implement rigorous host cell protein (HCP) analysis

    • Use multiple purification steps to ensure high purity

    • Include buffer-only and irrelevant protein controls

  • Aggregation monitoring:

    • Analyze by dynamic light scattering before experiments

    • Perform size exclusion chromatography to ensure monodispersity

    • Use negative stain electron microscopy to visualize protein state

  • Endotoxin testing:

    • For cell-based experiments, verify endotoxin levels are below threshold

    • Include polymyxin B controls to neutralize potential endotoxin effects

A systematic approach to validating that observed effects are specifically due to FLJ37107 rather than experimental artifacts is essential, particularly for uncharacterized proteins where unexpected functions may be discovered .

What techniques can determine if FLJ37107 undergoes post-translational modifications?

To investigate post-translational modifications (PTMs) of FLJ37107, researchers should employ multiple complementary techniques:

  • Mass spectrometry-based approaches:

    • Perform bottom-up proteomics with multiple proteases

    • Use enrichment strategies for specific PTMs (phosphorylation, glycosylation)

    • Employ electron transfer dissociation for PTM site localization

    • Compare PTM patterns between recombinant and endogenous protein

  • Gel-based detection:

    • Use Pro-Q Diamond for phosphorylation detection

    • Apply periodic acid-Schiff staining for glycosylation

    • Perform 2D gel electrophoresis to separate protein isoforms

  • Enzymatic treatments:

    • Test sensitivity to phosphatases, glycosidases, or deubiquitinases

    • Monitor mobility shifts before and after treatments

    • Quantify release of modification groups

  • Site-directed mutagenesis:

    • Mutate predicted modification sites (Ser, Thr, Tyr for phosphorylation)

    • Assess impact on protein function and localization

    • Compare wild-type and mutant protein behavior

  • Specific PTM antibodies:

    • Use modification-specific antibodies (phospho, acetyl, etc.)

    • Perform Western blotting before and after enzymatic treatments

    • Validate with immunoprecipitation followed by mass spectrometry

Since FLJ37107 is currently expressed in E. coli systems, which lack mammalian PTM machinery, comparing the recombinant protein with endogenously expressed protein can reveal important functional modifications that may be missing in the bacterial system .

How should researchers approach conflicting results when studying uncharacterized proteins like FLJ37107?

When confronting conflicting results in FLJ37107 research, implement this systematic approach:

  • Experimental variable analysis:

    • Create a comprehensive table documenting all experimental conditions

    • Identify subtle differences in protein preparation, concentration, buffers

    • Systematically test each variable's impact on outcomes

  • Cell line and context dependence:

    • Verify findings across multiple cell lines

    • Test under different physiological conditions (serum starvation, confluence)

    • Consider tissue-specific effects if contradictions occur between systems

  • Technical validation:

    • Employ orthogonal techniques to verify key findings

    • Increase biological and technical replicates

    • Perform power analysis to ensure adequate sample sizes

  • Collaborative verification:

    • Engage independent laboratories to reproduce critical experiments

    • Share detailed protocols and reagents to ensure comparability

    • Document all protocol variations when comparing results

  • Literature reconciliation:

    • Create a structured database of published findings

    • Classify results based on experimental systems and conditions

    • Identify patterns that might explain apparent contradictions

For uncharacterized proteins like FLJ37107, conflicting results often ultimately lead to discoveries about context-dependent functions or multiple molecular roles. Approaching contradictions as opportunities for deeper understanding rather than experimental failures can yield valuable insights.

What statistical approaches are most appropriate for analyzing FLJ37107 experimental data?

When analyzing experimental data for uncharacterized proteins like FLJ37107, employ these statistical approaches:

  • For expression analysis:

    • Use paired t-tests for before/after comparisons within same samples

    • Apply ANOVA with post-hoc tests for multi-condition experiments

    • Implement non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality cannot be assumed

  • For interaction studies:

    • Calculate enrichment scores relative to control pull-downs

    • Apply false discovery rate corrections for mass spectrometry data

    • Use permutation tests to establish significance thresholds

  • For functional assays:

    • Employ dose-response curve fitting for concentration-dependent effects

    • Use regression analysis to identify correlations between protein levels and phenotypes

    • Apply mixed-effects models when examining data across multiple cell lines

  • For omics integration:

    • Implement pathway enrichment analysis for RNA-seq after FLJ37107 perturbation

    • Use principal component analysis to identify major sources of variation

    • Apply network analysis to position FLJ37107 within interaction landscapes

  • For reproducibility assessment:

    • Calculate intraclass correlation coefficients between replicates

    • Perform Bland-Altman analysis for method comparisons

    • Use bootstrapping approaches to estimate confidence intervals

When working with an uncharacterized protein, robust statistical approaches that account for biological variability are essential. Given the potential for unexpected functions, statistical methods should balance sensitivity (to detect novel effects) with specificity (to avoid false positives).

How can animal models be effectively used to study the in vivo function of FLJ37107?

To investigate the in vivo function of FLJ37107 using animal models, researchers should consider this comprehensive approach:

  • Expression profiling across tissues and developmental stages:

    • Use RT-qPCR, in situ hybridization, and immunohistochemistry

    • Create reporter animals (knock-in of fluorescent protein)

    • Establish tissue and temporal expression patterns

  • Loss-of-function models:

    • Generate conventional knockout models

    • Develop conditional knockout systems (Cre-loxP) for tissue-specific deletion

    • Create inducible knockout systems for temporal control

    • Apply CRISPR-Cas9 for rapid generation of multiple alleles

  • Gain-of-function models:

    • Develop transgenic overexpression lines

    • Create knock-in models with constitutively active mutations

    • Establish inducible expression systems

  • Phenotypic analysis pipeline:

    • Perform comprehensive phenotyping (behavior, physiology, histology)

    • Use -omics approaches (transcriptomics, proteomics, metabolomics)

    • Conduct challenge studies (stress tests, disease models)

    • Examine aging effects and lifespan impacts

  • Humanized models:

    • Replace mouse FLJ37107 with human version

    • Assess functional conservation or divergence

    • Test human variants of unknown significance

When studying uncharacterized proteins like FLJ37107, beginning with careful expression profiling can guide subsequent functional studies by identifying tissues where the protein may have critical roles. Combining multiple model organisms (zebrafish, mice) can provide complementary insights and validation.

What considerations are important when designing quasi-experimental studies to investigate FLJ37107 function?

When designing quasi-experimental studies for investigating FLJ37107 function, researchers should consider:

  • Study design selection:

    • Choose higher-quality designs from the hierarchy of quasi-experimental approaches

    • Consider repeated-treatment designs (O1 X O2 removeX O3 X O4) to demonstrate causality

    • Implement non-equivalent dependent variable designs where appropriate

    • Use time-series designs when investigating dynamic processes

  • Controlling for confounding variables:

    • Identify and measure potential confounding factors

    • Use statistical controls and matching techniques

    • Implement propensity score methods for observational data

    • Consider instrumental variable approaches when randomization is impossible

  • Internal validity enhancement:

    • Include multiple control groups when feasible

    • Conduct sensitivity analyses for key assumptions

    • Implement difference-in-differences approaches

    • Use interrupted time series analysis for temporal data

  • Statistical power considerations:

    • Perform a priori power analyses based on expected effect sizes

    • Consider clustered or hierarchical data structures in calculations

    • Plan for potential attrition or missing data

    • Determine appropriate sample sizes for subgroup analyses

  • Reporting and transparency:

    • Document all methodological decisions and their rationales

    • Pre-register study designs and analysis plans

    • Report all measured variables and outcomes

    • Discuss threats to internal and external validity

For studies of uncharacterized proteins like FLJ37107, quasi-experimental designs can be particularly valuable when ethical or practical constraints prevent randomized experiments. The removed-treatment design can be especially informative as it allows testing hypotheses about outcomes in both the presence and absence of interventions .

What specialized mass spectrometry approaches are recommended for FLJ37107 characterization?

For comprehensive characterization of FLJ37107 using mass spectrometry, researchers should employ these specialized approaches:

  • Intact protein analysis (top-down proteomics):

    • Perform high-resolution MS analysis of the intact protein

    • Measure exact molecular weight and identify proteoforms

    • Use electron-capture dissociation for fragment analysis

    • Compare theoretical and experimental masses to identify modifications

  • Hydrogen-deuterium exchange MS (HDX-MS):

    • Map solvent-accessible regions of the protein

    • Identify potential binding interfaces

    • Monitor structural changes under different conditions

    • Compare experimental conditions to detect conformational shifts

  • Cross-linking MS (XL-MS):

    • Use chemical crosslinkers to capture protein-protein interactions

    • Apply specialized search algorithms to identify crosslinked peptides

    • Generate distance constraints for structural modeling

    • Create interaction maps with partner proteins

  • Native MS:

    • Analyze FLJ37107 under non-denaturing conditions

    • Determine oligomerization state and complex formation

    • Assess binding of small molecules or cofactors

    • Examine stability under different buffer conditions

  • Targeted quantitative MS:

    • Develop selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) assays

    • Quantify FLJ37107 expression across tissues or conditions

    • Monitor specific post-translational modifications

    • Measure turnover rates using pulse-chase with isotope labeling

These advanced MS techniques provide complementary information about FLJ37107's structure, interactions, and modifications that cannot be obtained through standard proteomic approaches alone. When combined, they create a multi-dimensional view of this uncharacterized protein that can guide functional hypotheses .

How can computational modeling enhance understanding of FLJ37107?

Computational modeling can significantly enhance understanding of uncharacterized proteins like FLJ37107 through these approaches:

  • Structural prediction and analysis:

    • Apply AlphaFold2 or RoseTTAFold for tertiary structure prediction

    • Perform molecular dynamics simulations to assess stability

    • Identify potential binding pockets and functional sites

    • Compare structural features with functionally characterized proteins

  • Molecular docking studies:

    • Screen small molecule libraries for potential binding partners

    • Model protein-protein interactions with predicted partners

    • Identify key residues involved in molecular recognition

    • Guide design of experimental validation studies

  • Evolutionary analysis:

    • Construct phylogenetic trees to trace evolutionary history

    • Identify conserved regions suggesting functional importance

    • Detect signs of positive selection indicating adaptive evolution

    • Perform ancestral sequence reconstruction to understand evolutionary trajectory

  • Multi-scale modeling:

    • Integrate protein-level models with cellular pathway simulations

    • Predict phenotypic outcomes of FLJ37107 perturbation

    • Model dynamics of potential signaling pathways involving FLJ37107

    • Simulate effects of mutations on protein function

  • Machine learning approaches:

    • Apply deep learning to predict protein function from sequence

    • Use natural language processing to mine literature for related proteins

    • Develop gene expression-based predictors of FLJ37107 activity

    • Integrate diverse data types to generate functional hypotheses

Computational approaches are particularly valuable for uncharacterized proteins, as they can generate testable hypotheses that guide experimental design and help prioritize the most promising research directions. The highly hydrophobic C-terminal region of FLJ37107 suggests potential for membrane interaction, which could be specifically modeled to predict orientation and stability in lipid bilayers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.