Recombinant Human Putative uncharacterized protein LOC388820

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SMIM34; SMIM34A; Small integral membrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM34A
Target Protein Sequence
MEWAKWTPHEASNQTQASTLLGLLLGDHTEGRNDTNSTRALKVPDGTSAAWYILTIIGIY AVIFVFRLASNILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQA HLGAKGGSSGPQTATPETP
Uniprot No.

Target Background

Database Links

HGNC: 39601

KEGG: hsa:107983987

STRING: 9606.ENSP00000397039

UniGene: Hs.567951

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the structural characteristics of human putative uncharacterized protein LOC388820?

Human putative uncharacterized protein LOC388820 remains largely uncharacterized in terms of its three-dimensional structure. Based on homology with related proteins like LOC102846498 from Elephantulus edwardii, it is predicted to be a relatively small protein with an open reading frame of approximately 336 base pairs . While X-ray crystallography or NMR spectroscopy data is not yet available, computational predictions suggest potential structural motifs. Researchers approaching this protein should consider employing circular dichroism spectroscopy to determine secondary structure elements and thermal stability assessments prior to functional studies.

Which expression systems are most suitable for recombinant human LOC388820 production?

Based on experimental design approaches used for other recombinant human proteins, E. coli remains a primary expression system for initial characterization due to its rapid growth, high yield potential, and cost-effectiveness . For human LOC388820, consider the following expression systems with their respective advantages:

Expression SystemAdvantagesPotential Limitations
E. coliHigh yield, economical, rapid growthLacks post-translational modifications, potential for inclusion bodies
Mammalian (HEK293, CHO)Native post-translational modifications, proper foldingHigher cost, lower yield, longer production time
Insect cells (Sf9, Hi5)Post-translational modifications, high expressionModerate cost, glycosylation patterns differ from human
Yeast (P. pastoris)High density culture, secretion capabilityHyperglycosylation may occur

The optimal system should be determined experimentally, with initial screening in E. coli followed by mammalian expression if proper folding or post-translational modifications appear necessary for functionality .

What purification strategies are recommended for recombinant human LOC388820?

For initial purification attempts, affinity chromatography using an N-terminal or C-terminal His-tag is recommended, similar to approaches used for other recombinant human proteins . A typical purification workflow would include:

  • Affinity chromatography using Ni-NTA or Co-NTA resin

  • Size exclusion chromatography to remove aggregates and obtain monomeric protein

  • Ion exchange chromatography for further purification if necessary

Consider using a carrier-free (CF) formulation for applications where the presence of carrier proteins might interfere with functional studies . Purification should aim for at least 75% homogeneity as demonstrated for other recombinant proteins .

How should expression conditions be optimized for soluble LOC388820 production?

Optimization of expression conditions is critical for obtaining soluble recombinant LOC388820. A multivariate statistical experimental design approach is strongly recommended over the traditional univariate method . This approach allows for the simultaneous evaluation of multiple variables while minimizing the number of experiments required.

Key variables to consider in a factorial design include:

  • Induction temperature (typically test 18°C, 25°C, and 37°C)

  • Inducer concentration (IPTG: 0.1-1.0 mM range)

  • Induction time (4-6 hours often optimal for balance between yield and solubility)

  • Media composition (test enriched vs. minimal media)

  • Cell density at induction (OD600 between 0.6-1.2)

  • Post-induction growth time

  • Presence of solubility enhancers (e.g., sorbitol, betaine)

  • Co-expression with chaperones

A fractional factorial screening design (2^8-4) with center point replicates would enable evaluation of these variables with reasonable experimental effort . For each condition, evaluate three key responses: cell growth, biological activity, and productivity of the recombinant protein.

What are the recommended methods for assessing LOC388820 functionality?

As an uncharacterized protein, functional assessment of LOC388820 requires multiple complementary approaches:

  • Binding assays: Use surface plasmon resonance or bio-layer interferometry to identify potential binding partners. For example, when assessing protein-protein interactions, immobilize LOC388820 at approximately 2 μg/mL and test binding with candidate proteins .

  • Enzymatic activity screening: Test for potential enzymatic activities using substrate panels based on bioinformatic predictions of protein domains.

  • Cell-based functional assays: Evaluate effects of recombinant LOC388820 on cellular processes by:

    • Treating cells with purified protein

    • Overexpressing the protein in relevant cell lines

    • Knocking down endogenous expression using siRNA/CRISPR

  • Protein-protein interaction studies: Use pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening to identify interaction partners.

Document all experimental conditions thoroughly, as differences in assay conditions can lead to contradictory results in the literature .

How can researchers verify the identity and integrity of expressed LOC388820?

Verification of recombinant LOC388820 should include multiple analytical techniques:

Analytical MethodPurposeTypical Results
SDS-PAGEAssess purity and molecular weightSingle band at predicted MW
Western blotConfirm identity using tag-specific or protein-specific antibodiesSpecific band at expected MW
Mass spectrometryDetermine accurate mass and sequence coverage>80% sequence coverage
N-terminal sequencingVerify correct translation start siteMatch to predicted sequence
Dynamic light scatteringAssess homogeneity and aggregation stateMonodisperse population
Circular dichroismEvaluate secondary structureProperly folded protein signature

Always run both reducing and non-reducing SDS-PAGE to evaluate potential disulfide bond formation, as seen in the analysis of other recombinant proteins .

What strategies are recommended for resolving contradictions in LOC388820 functional characterization?

When encountering contradictory findings regarding LOC388820 function in the literature, apply a structured approach to context analysis as outlined in biomedical contradiction research :

  • Identify specific contradiction types:

    • Direct negation (e.g., "LOC388820 activates pathway X" vs. "LOC388820 does not activate pathway X")

    • Opposing effects (e.g., "LOC388820 increases cell proliferation" vs. "LOC388820 inhibits cell proliferation")

  • Analyze contextual factors that may explain contradictions:

    • Experimental models (cell lines, animal models)

    • Experimental conditions (temperature, pH, cofactors)

    • Protein constructs (full-length vs. truncated versions)

    • Post-translational modifications

    • Species differences

  • Perform normalization of terminology across studies to ensure comparing equivalent entities:

    • Standard gene/protein nomenclature

    • Standardized experimental methods

    • Consistent endpoint measurements

  • Design reconciliation experiments that directly test hypotheses about contextual factors causing contradictions.

Maintain a comprehensive database of experimental conditions and results to facilitate systematic analysis of context-dependent effects .

How should researchers approach structure-function studies for LOC388820?

For this uncharacterized protein, a systematic domain-based approach is recommended:

  • In silico analysis:

    • Perform sequence-based domain prediction using tools like PFAM, SMART, or InterPro

    • Conduct homology modeling based on structurally characterized homologs

    • Use disorder prediction algorithms to identify flexible regions

  • Domain mapping through truncation constructs:

    • Design a series of N-terminal and C-terminal truncation constructs

    • Express and purify each construct using optimized conditions

    • Assess folding and stability of each construct

    • Evaluate functional properties of each construct

  • Site-directed mutagenesis:

    • Identify conserved residues through multiple sequence alignment

    • Design mutations targeting these residues

    • Express and characterize mutant proteins

    • Correlate functional changes with structural elements

  • Structural biology approaches:

    • For soluble domains, attempt crystallization trials

    • Consider NMR for smaller domains

    • Use hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

Document the experimental conditions thoroughly to ensure reproducibility and facilitate integration of results from different approaches.

What considerations are important for designing LOC388820 knockout or knockdown studies?

When designing genetic manipulation studies to elucidate LOC388820 function:

  • Target selection:

    • Design multiple siRNAs or sgRNAs targeting different regions of the LOC388820 transcript

    • Validate specificity using off-target prediction algorithms

    • Consider potential functional redundancy with related proteins

  • Control design:

    • Include scrambled siRNA or non-targeting sgRNA controls

    • Consider rescue experiments with siRNA-resistant constructs

    • Use validated positive controls for the phenotypic assays employed

  • Validation strategy:

    • Confirm knockdown/knockout at both mRNA level (qRT-PCR) and protein level (western blot)

    • Quantify knockdown efficiency and correlate with phenotypic effects

    • Assess potential compensatory upregulation of related genes

  • Phenotypic analysis:

    • Employ multiple complementary assays rather than relying on a single readout

    • Include time-course analyses to detect transient effects

    • Consider context dependency by varying experimental conditions

Remember that conflicting phenotypic results may arise from differences in cell types, growth conditions, or the extent of protein depletion .

What are the recommended steps for initial characterization of LOC388820 cellular localization?

Determining the cellular localization of LOC388820 requires a multi-method approach:

  • Bioinformatic prediction:

    • Use algorithms like TargetP, PSORT, and SignalP to predict subcellular localization

    • Identify potential localization signals (nuclear localization sequence, mitochondrial targeting, etc.)

  • Fluorescent protein fusion:

    • Generate N- and C-terminal GFP/mCherry fusions of LOC388820

    • Express in relevant cell lines

    • Perform live-cell imaging to observe distribution

    • Validate with fixed-cell imaging and co-localization with organelle markers

  • Immunofluorescence:

    • Generate validated antibodies against LOC388820 or use epitope tags

    • Perform immunofluorescence in fixed cells

    • Co-stain with markers for subcellular compartments

  • Biochemical fractionation:

    • Perform subcellular fractionation of cells expressing LOC388820

    • Analyze fractions by western blot to determine protein distribution

    • Compare with established markers of cellular compartments

The combination of these approaches provides robust evidence for protein localization, minimizing artifacts associated with any single method.

How should researchers optimize storage conditions for recombinant LOC388820?

Proper storage of recombinant LOC388820 is critical for maintaining its integrity and functionality over time. Based on practices for other recombinant proteins, consider the following recommendations :

Storage FormRecommended ConditionsStability Considerations
Lyophilized-20°C or -80°C in sealed containersMost stable form, reconstitute immediately before use
Solution-80°C with 15-25% glycerolAvoid repeated freeze-thaw cycles
Working aliquots4°C for up to 1 weekAdd stabilizers as needed based on stability testing

For lyophilized protein, reconstitute at approximately 250 μg/mL in an appropriate buffer based on downstream applications . Perform stability studies to determine optimal buffer conditions by assessing:

  • Thermal stability using differential scanning fluorimetry

  • Aggregation propensity using dynamic light scattering

  • Functional stability through activity assays at different time points

  • Freeze-thaw stability by monitoring activity after multiple cycles

Document storage conditions thoroughly when reporting experimental results to enable proper reproduction by other researchers.

What strategies can help overcome solubility issues during LOC388820 expression?

If initial expression attempts yield insoluble LOC388820, implement a systematic troubleshooting approach:

  • Fusion tag screening:

    • Test different solubility-enhancing tags (MBP, SUMO, TrxA, GST)

    • Compare N-terminal versus C-terminal tag placement

    • Evaluate the effect of linker length between tag and protein

  • Expression condition modification:

    • Reduce induction temperature (16-20°C)

    • Decrease inducer concentration

    • Use auto-induction media for gradual protein expression

    • Extend expression time at lower temperatures

  • Co-expression strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Include disulfide bond isomerases for proteins with cysteine residues

    • Co-express with binding partners if known

  • Buffer optimization:

    • Screen various pH conditions (typically pH 6.5-8.0)

    • Test different salt concentrations (100-500 mM NaCl)

    • Add stabilizing agents (glycerol, arginine, trehalose)

    • Include reducing agents if appropriate (DTT, TCEP)

  • Refolding from inclusion bodies:

    • If soluble expression fails, develop a refolding protocol

    • Use gradual dialysis or on-column refolding methods

    • Screen refolding additives (L-arginine, detergents, cyclodextrins)

Implement a multivariate experimental design to efficiently explore these variables with minimal experimental effort .

How can LOC388820 be incorporated into protein-protein interaction networks?

To integrate LOC388820 into known protein interaction networks:

  • Affinity purification-mass spectrometry:

    • Express tagged LOC388820 in relevant cell lines

    • Perform pull-downs under physiological conditions

    • Identify binding partners by mass spectrometry

    • Validate key interactions by reciprocal co-immunoprecipitation

  • Proximity labeling approaches:

    • Generate BioID or APEX2 fusions with LOC388820

    • Express in relevant cell types and activate labeling

    • Identify proximal proteins by streptavidin pull-down and mass spectrometry

    • Compare results from different cellular compartments

  • Yeast two-hybrid screening:

    • Use LOC388820 as bait in Y2H screens

    • Test against human cDNA libraries or defined protein sets

    • Validate positive interactions in mammalian cells

  • Computational network integration:

    • Use existing protein interaction databases to predict functional associations

    • Apply network analysis algorithms to position LOC388820 in known pathways

    • Generate testable hypotheses about protein function based on network position

Carefully document all experimental conditions to enable proper interpretation of results and avoid contradictory findings in the literature .

What are the key considerations for developing antibodies against LOC388820?

Development of specific antibodies against LOC388820 requires careful planning:

  • Antigen design:

    • Analyze the protein sequence for immunogenic regions

    • Consider both recombinant full-length protein and synthetic peptides

    • Avoid regions with high similarity to other human proteins

    • Select multiple targets to increase success probability

  • Validation strategy:

    • Test antibody specificity against recombinant protein

    • Confirm recognition of endogenous protein by western blot

    • Validate by siRNA/CRISPR knockout of target

    • Perform immunoprecipitation followed by mass spectrometry

  • Application optimization:

    • Determine optimal conditions for each application (western blot, immunofluorescence, ChIP)

    • Document all experimental parameters thoroughly

    • Establish positive and negative controls for each application

  • Cross-reactivity assessment:

    • Test against related human proteins

    • Evaluate species cross-reactivity if relevant

    • Screen tissue panels for non-specific binding

Thorough validation and documentation of antibody characteristics are essential to avoid contradictory results in subsequent research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.