Recombinant Human Putative uncharacterized protein PRO1933 (PRO1933)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PRO1933; Putative uncharacterized protein PRO1933
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PRO1933
Target Protein Sequence
MNKHNLRLVQLASELILIEIIPKLFLSQVTTISHIKREKIPPNHRKGILCMFPWQCVVYV FSNFVWLVIHRFSNGFIQFLGEPYRLMTASGTHGRIKFMVDIPIIKNTQVLRIPVLKDPK MLSKKH
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant PRO1933?

Recombinant PRO1933 requires specific storage conditions to maintain stability and activity:

  • Store at -20°C for regular storage or -80°C for extended storage

  • For working solutions, maintain aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles that can lead to protein degradation

  • The optimal buffer composition is Tris-based buffer with 50% glycerol

  • Use small working aliquots rather than repeatedly freezing and thawing the main stock

These conditions are critical for maintaining protein integrity during experimental workflows and ensuring reproducible results across studies.

What expression systems are most effective for producing recombinant PRO1933?

While specific expression system information for PRO1933 is limited in the literature, the following approaches have proven successful for similar uncharacterized human proteins:

Expression SystemAdvantagesLimitationsRecommended Use Case
E. coli (bacterial)High yield, rapid growth, cost-effectiveLimited post-translational modifications, potential inclusion bodiesInitial structural studies, antibody production
Yeast (P. pastoris)Eukaryotic processing, moderate cost, scalableHyperglycosylationBalance between authentic processing and yield
Insect cells (Baculovirus)More complex eukaryotic modificationsHigher cost, longer production timeWhen bacterial expression fails
Mammalian cells (HEK293/CHO)Human-like modifications, proper foldingHighest cost, lower yieldsFunctional studies requiring authentic modifications

For PRO1933, a systematic approach beginning with E. coli expression (as mentioned in product specifications from suppliers) with appropriate tags is recommended, advancing to more complex systems if necessary for specific research objectives .

How can I optimize the purification protocol for recombinant PRO1933?

Purification of recombinant PRO1933 requires a carefully designed protocol:

  • Initial extraction considerations:

    • Use appropriate lysis buffers containing protease inhibitors

    • Optimize cell disruption method (sonication, French press, or chemical lysis)

    • Centrifugation parameters should be adjusted to effectively separate soluble protein (≥12,000 × g for 30-35 minutes at 4°C)

  • Affinity chromatography approach:

    • Utilize the affinity tag determined during production (commonly His-tag)

    • For His-tagged PRO1933, use Immobilized Metal Affinity Chromatography (IMAC) with Ni-NTA or Co-NTA resins

    • Optimize binding, washing, and elution conditions to maximize purity

  • Secondary purification:

    • Size exclusion chromatography (SEC) can separate monomeric PRO1933 from aggregates

    • Ion exchange chromatography may further improve purity based on PRO1933's charge properties

    • Consider 2D gel electrophoresis for analytical assessment of purity

  • Quality control:

    • Verify purity via SDS-PAGE (aim for ≥85% purity)

    • Confirm identity using Western blotting or mass spectrometry

    • Assess activity/functionality through appropriate assays

Optimization may require iterative adjustments to buffer compositions, pH, salt concentrations, and chromatography conditions specific to PRO1933's physicochemical properties .

How should I design experiments to investigate the potential function of this uncharacterized protein?

Investigating an uncharacterized protein like PRO1933 requires a multi-tiered experimental strategy:

  • Bioinformatic analysis (preliminary phase):

    • Sequence analysis to identify conserved domains and motifs

    • Structural prediction using tools like AlphaFold

    • Phylogenetic analysis to identify evolutionary relationships

    • Literature mining for related proteins

  • Expression and localization studies (first-tier experiments):

    • Generate expression constructs with fluorescent tags

    • Determine subcellular localization in relevant cell types

    • Assess tissue-specific expression patterns

    • Analyze expression changes under different conditions

  • Interaction studies (second-tier experiments):

    • Implement co-immunoprecipitation coupled with mass spectrometry

    • Use proximity labeling methods (BioID, APEX)

    • Perform yeast two-hybrid or mammalian two-hybrid screening

    • Validate key interactions with orthogonal methods

  • Functional perturbation (third-tier experiments):

    • Generate knockout/knockdown models

    • Perform overexpression studies

    • Analyze resulting phenotypes using appropriate assays

    • Conduct rescue experiments with wild-type and mutant constructs

  • Pathway analysis (integrative experiments):

    • Transcriptome analysis after PRO1933 manipulation

    • Proteome and phosphoproteome profiling

    • Metabolic profiling if appropriate

This systematic approach provides complementary lines of evidence to establish PRO1933's function, with each tier building upon previous findings .

What statistical considerations are important when designing PRO1933 experiments?

Statistical rigor is essential in studies of uncharacterized proteins like PRO1933:

  • Experimental design principles:

    • Implement proper randomization to minimize batch effects

    • Include adequate biological replicates (minimum n=3, preferably n≥5)

    • Calculate sample size using power analysis before beginning experiments

    • Consider propensity score matching to reduce bias in comparative studies

  • Control selection:

    • Include both positive and negative controls appropriate for each assay

    • For interaction studies, use known non-interacting proteins as negative controls

    • For functional studies, include well-characterized proteins with similar attributes

  • Statistical analysis approaches:

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple testing when analyzing high-throughput data

    • Consider using penalized regression models for high-dimensional data analysis

    • The LASSO-LASSO combination has shown superior performance in some proteomic contexts

  • Data validation:

    • Validate key findings using orthogonal methods

    • Perform cross-validation for predictive models

    • Report effect sizes along with p-values to assess biological significance

Following these principles will strengthen the reliability and reproducibility of findings related to PRO1933 .

What proteomic approaches can help identify the function of PRO1933?

Proteomics offers powerful tools for characterizing uncharacterized proteins:

  • Protein-protein interaction analysis:

    • Affinity purification-mass spectrometry (AP-MS) using tagged PRO1933

    • Proximity labeling (BioID, APEX) to identify the proximal proteome

    • Cross-linking mass spectrometry to map interaction interfaces

    • Two-dimensional gel electrophoresis can identify differential protein spots when comparing control and PRO1933-expressing samples

  • Differential proteomics:

    • Compare proteome changes in PRO1933 knockout vs. wild-type cells

    • Use techniques like SILAC, TMT, or label-free quantification

    • Analyze using appropriate statistical methods as described in comprehensive proteomics workflows

    • Create study design tables following established methodologies

  • Structural proteomics:

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

    • Limited proteolysis coupled with mass spectrometry to identify domains

    • Native mass spectrometry to determine oligomeric states

  • Post-translational modification analysis:

    • Phosphoproteomics to identify regulatory mechanisms

    • Ubiquitylation analysis to assess protein stability regulation

    • Glycoproteomics if PRO1933 is predicted to be glycosylated

Integration of these approaches with proper experimental design and statistical analysis can provide comprehensive insights into PRO1933 function .

How can I develop assays to detect potential enzymatic activity of PRO1933?

Without prior knowledge of PRO1933's function, a systematic approach to enzymatic activity detection is required:

  • Prediction-based screening:

    • Use bioinformatic tools to predict potential enzymatic functions

    • Screen for activities based on predicted structural similarities to known enzymes

    • Test multiple buffer conditions, cofactors, and substrates

  • Activity-based protein profiling:

    • Use activity-based probes to identify catalytic mechanisms

    • Apply chemical proteomics approaches for unbiased activity detection

    • Screen with compound libraries to identify potential substrates or inhibitors

  • Metabolite profiling:

    • Compare metabolite profiles between PRO1933-expressing and control cells

    • Look for accumulation or depletion of specific metabolites

    • Trace isotope-labeled potential substrates to detect conversion products

  • Assay development considerations:

    • Optimize protein concentration, buffer composition, and reaction conditions

    • Include appropriate positive and negative controls

    • Design assays with sufficient sensitivity and dynamic range

    • Validate with orthogonal methods to confirm specific activity

  • High-throughput screening:

    • Develop miniaturized assays suitable for screening if initial tests show promise

    • Screen against libraries of potential substrates

    • Use computational approaches to predict enzyme-substrate interactions

This systematic approach maximizes the chance of identifying enzymatic activity in an uncharacterized protein like PRO1933 .

What computational methods can predict the structure of PRO1933?

Computational structure prediction provides valuable insights for uncharacterized proteins:

  • AI-based structure prediction:

    • AlphaFold2 and RoseTTAFold have revolutionized protein structure prediction

    • Submit PRO1933 sequence to these platforms for high-confidence structural models

    • Evaluate prediction confidence scores for different regions

  • Homology modeling:

    • Identify templates with similar sequence through BLAST or HHpred

    • Use software like MODELLER or SWISS-MODEL for model building

    • Validate models using tools like PROCHECK, VERIFY3D, and MolProbity

  • Ab initio methods:

    • Use fragment-based methods like Rosetta for regions lacking homology

    • Apply molecular dynamics simulations to refine models

    • Implement coarse-grained modeling for preliminary structural insights

  • Functional site prediction:

    • Identify potential binding pockets using tools like CASTp or fpocket

    • Predict functional sites based on evolutionary conservation

    • Perform in silico docking to identify potential ligands

  • Validation and refinement:

    • Assess model quality using multiple validation metrics

    • Refine models with molecular dynamics simulations

    • Compare with experimental data when available

These computational approaches provide testable hypotheses about PRO1933 structure that can guide experimental studies .

What experimental methods are appropriate for determining PRO1933 structure?

Experimental structure determination requires careful consideration of PRO1933's properties:

The choice of method should be guided by research objectives and PRO1933's biochemical properties .

How should I analyze transcriptomic data related to PRO1933 manipulation?

Transcriptomic analysis after PRO1933 manipulation requires rigorous analytical approaches:

  • Experimental design considerations:

    • Include appropriate biological replicates (minimum n=3)

    • Control for confounding variables using strategies like propensity score matching

    • Design the experiment based on clear hypotheses about PRO1933 function

  • RNA-seq data analysis workflow:

    • Quality control and preprocessing of raw sequencing data

    • Alignment to reference genome or transcriptome assembly

    • Quantification of gene expression levels

    • Differential expression analysis with tools like DESeq2 or edgeR

    • Multiple testing correction to control false discovery rate

  • Functional interpretation:

    • Gene Ontology (GO) enrichment analysis

    • Pathway analysis using resources like KEGG or Reactome

    • Gene set enrichment analysis (GSEA)

    • Network analysis to identify co-regulated genes

  • Integration with other data types:

    • Correlation with proteomics data if available

    • Integration with ChIP-seq or other epigenomic data

    • Comparison with public datasets for context

  • Validation strategies:

    • Confirm key findings with qRT-PCR

    • Validate at the protein level for selected targets

    • Test predictions with functional assays

This approach can reveal the transcriptional networks and pathways affected by PRO1933, providing insights into its biological role .

What statistical methods are appropriate for proteomics data involving PRO1933?

Analysis of proteomics data involving PRO1933 requires specialized statistical approaches:

  • Preprocessing and quality control:

    • Normalization to account for technical variation

    • Log transformation to stabilize variance

    • Assessment of missing values and appropriate imputation strategies

    • Batch effect correction if necessary

  • Differential abundance analysis:

    • For large proteomics datasets, apply methods like LIMMA or MSstats

    • Consider using penalized regression models such as LASSO or elastic net

    • The LASSO-LASSO approach has shown superior performance with an AUC improvement of 0.107 in related proteomics contexts

  • Multiple testing correction:

    • Apply appropriate methods (e.g., Benjamini-Hochberg procedure)

    • Consider the false discovery rate (FDR) threshold based on study objectives

    • Report both unadjusted and adjusted p-values for transparency

  • Multivariate analysis:

    • Principal Component Analysis (PCA) for dimensionality reduction

    • Clustering methods to identify protein groups with similar patterns

    • Network analysis to identify protein modules

  • Visualization strategies:

    • Volcano plots for differential abundance analysis

    • Heatmaps for protein expression patterns

    • Network visualizations for protein interactions

    • Create appropriate study design tables as shown in examples

These statistical approaches help extract meaningful information from complex proteomics data while controlling false positives and false negatives .

Why might I experience poor expression of recombinant PRO1933?

Poor expression of recombinant PRO1933 can result from several factors:

  • Codon usage optimization issues:

    • Human proteins often contain codons rare in expression hosts

    • Solution: Use codon-optimized gene synthesis or Rosetta strains

    • For PRO1933, analyze the coding sequence for rare codons using tools like Rare Codon Calculator

  • Toxicity to host cells:

    • Some proteins may be toxic to the expression host

    • Signs: Slow growth, plasmid instability, or cell death after induction

    • Solution: Use tightly controlled inducible promoters, reduce expression temperature (16-20°C), or try different host strains

  • Protein folding challenges:

    • Improper folding can lead to aggregation or degradation

    • Solution: Co-express with chaperones (GroEL/ES, DnaK), use folding-enhancing tags (MBP, SUMO), or adjust induction conditions

  • Expression conditions:

    • Suboptimal induction timing or conditions

    • Solution: Optimize induction OD (typically 0.6-0.8 for E. coli), inducer concentration, and post-induction time

    • Test expression at different temperatures (37°C for yield, 16-20°C for solubility)

  • Vector design:

    • Incompatible promoter or weak ribosome binding site

    • Solution: Try different expression vectors with stronger or more compatible promoters

    • Optimize the sequence around the start codon for efficient translation initiation

Systematic optimization of these parameters is recommended to achieve optimal expression of PRO1933 .

How can I address issues with protein degradation during PRO1933 purification?

Protein degradation during purification can significantly impact studies:

  • Buffer optimization:

    • According to specifications, PRO1933 is stable in Tris-based buffer with 50% glycerol

    • Test different pH conditions (typically pH 7.0-8.0)

    • Add stabilizing agents such as reducing agents (DTT, β-mercaptoethanol) if the protein contains cysteines

    • Consider adding mild detergents (0.01-0.05% Tween-20) to prevent aggregation

  • Protease inhibition strategies:

    • Add comprehensive protease inhibitor cocktails during extraction and purification

    • Include specific inhibitors based on observed degradation patterns

    • Keep samples cold (4°C) throughout the purification process

    • Consider using protease-deficient expression strains

  • Chromatography considerations:

    • Minimize time spent during purification steps

    • Collect smaller fractions to avoid extended exposure to potentially destabilizing conditions

    • Consider on-column refolding for proteins expressed as inclusion bodies

  • Storage optimization:

    • Follow the recommended storage conditions: -20°C for regular storage or -80°C for extended periods

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • Add protein stabilizers like glycerol (final concentration 10-50%) or sucrose

  • Analytical assessment:

    • Monitor protein integrity by SDS-PAGE and Western blotting

    • Use size exclusion chromatography to analyze aggregation state

    • Consider thermal shift assays to identify stabilizing conditions

Implementing these strategies will help maintain PRO1933 integrity throughout purification and downstream applications .

How can I use CRISPR/Cas9 to study PRO1933 function?

CRISPR/Cas9 technology provides powerful tools for investigating PRO1933:

  • Knockout strategies:

    • Design multiple sgRNAs targeting early exons of PRO1933

    • Create complete knockout cell lines using CRISPR/Cas9

    • Confirm knockout by sequencing, RT-PCR, and Western blotting

    • Perform phenotypic analysis including growth, morphology, and functional assays

    • Conduct rescue experiments with wild-type PRO1933 to confirm specificity

  • Endogenous tagging approaches:

    • Insert epitope tags (HA, FLAG) or fluorescent proteins (GFP, mCherry) at the C- or N-terminus

    • Use homology-directed repair with appropriate donor templates

    • This allows visualization and purification of PRO1933 at physiological levels

    • Essential for studying authentic localization and interactions

  • Domain mapping:

    • Create precise deletions of predicted functional domains

    • Enables mapping of regions required for specific functions or interactions

    • Design repair templates with specific modifications for homology-directed repair

  • CRISPR activation/interference:

    • Use dCas9 fused to transcriptional activators (CRISPRa) or repressors (CRISPRi)

    • Modulate PRO1933 expression without modifying the genomic sequence

    • Useful for dose-dependent studies and temporal control

  • High-throughput CRISPR screens:

    • Perform genome-wide or focused CRISPR screens with PRO1933 knockout

    • Identify synthetic lethal or synthetic rescue interactions

    • Provides insights into functional pathways and potential compensatory mechanisms

These approaches can provide comprehensive insights into PRO1933 function in physiologically relevant contexts .

What integrative multi-omics approaches would best characterize PRO1933 function?

Integrative multi-omics provides the most comprehensive characterization of uncharacterized proteins:

  • Combined transcriptomics and proteomics:

    • RNA-seq to identify transcriptional changes after PRO1933 manipulation

    • Proteomics to assess corresponding protein-level changes

    • Correlation analysis between transcriptome and proteome datasets

    • Integration methods similar to those used in transcriptome studies

  • Interactome mapping:

    • Affinity purification-mass spectrometry to identify physical interactors

    • Proximity labeling to map the spatial environment of PRO1933

    • Yeast two-hybrid or mammalian two-hybrid screening for binary interactions

    • Network analysis to place PRO1933 in functional contexts

  • Structural integration:

    • Combine computational structure prediction with experimental validation

    • Map interaction sites and functional domains

    • Relate structure to identified interactions and functions

  • Functional genomics integration:

    • CRISPR screens to identify genetic interactions

    • Phenotypic profiling after PRO1933 manipulation

    • Correlation with public functional genomics datasets

  • Systems biology modeling:

    • Develop predictive models of PRO1933 function

    • Integrate multiple data types using machine learning approaches

    • Test model predictions with targeted experiments

    • Apply propensity score matching to reduce bias in comparative analyses

This integrative approach provides multiple lines of evidence to establish PRO1933 function, with each method complementing and validating others while overcoming the limitations of individual techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.