Recombinant Human Putative uncharacterized protein UNQ5815/PRO19632 (UNQ5815/PRO19632)

Shipped with Ice Packs
In Stock

Description

Predicted Roles

Bioinformatic analyses propose two conflicting functional hypotheses:

  1. Endoplasmic Reticulum (ER) Membrane Complex:

    • Part of the EMC involved in membrane protein insertion .

    • Potential Mg²⁺ transporter (TC 1.A.67 family) .

  2. Vacuolar ATPase (V-ATPase) Assembly:

    • May assist V0 complex assembly in the ER (VMA21 family) .

Subcellular Localization: Predominantly ER membrane, with conflicting reports of Golgi apparatus localization .

Production and Quality Control

Recombinant Expression:

  • Host: E. coli .

  • Tag: His tag facilitates affinity chromatography .

Quality Metrics:

  • Purity: ≥85–90% by SDS-PAGE .

  • Reconstitution: Requires sterile water + glycerol (5–50%) for solubility .

Target in Drug Screening

Patent US9885711 describes its use in identifying kinetic modulators (e.g., antibodies) that alter binding kinetics of signaling complexes . Key parameters for screening include:

ParameterRange
Binding affinity shift1.5–1000-fold
Preferred modulationPositive (enhanced binding)

Limitations and Open Questions

  • Functional Validation: No wet-lab studies confirming ER or V-ATPase roles .

  • Pathway Associations: Commercial databases list no confirmed pathways .

  • Interactome: No experimentally validated protein partners reported .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
UNQ5815/PRO19632; Putative uncharacterized protein UNQ5815/PRO19632
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
UNQ5815/PRO19632
Target Protein Sequence
MQIQNNLFFCCYTVMSAIFKWLLLYSLPALCFLLGTQESESFHSKAEILVTLSQVIISPA GPHALTWTTHFSPSVIIILVPCWWHAVIVTQHPVANCYVTNHLNIQWLELKAGS
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant UNQ5815/PRO19632?

E. coli expression systems have been successfully employed for recombinant production of UNQ5815/PRO19632, particularly with N-terminal His-tag fusion for purification purposes. For optimal expression:

  • Consider using BL21(DE3) or Rosetta strains to address potential codon bias issues

  • Optimize induction conditions (IPTG concentration, temperature, duration) to balance yield with solubility

  • Test multiple fusion tags (His, GST, MBP) to identify optimal solubility and stability

  • Screen various lysis buffers with different detergents if membrane association causes solubility challenges

While E. coli is commonly used, mammalian expression systems (HEK293 or CHO cells) may be preferable for studies requiring post-translational modifications or proper folding of transmembrane domains .

What storage conditions are recommended for recombinant UNQ5815/PRO19632?

Proper storage is critical for maintaining protein activity. For recombinant UNQ5815/PRO19632:

  • Store lyophilized powder at -20°C or preferably -80°C for long-term storage

  • After reconstitution, add glycerol to a final concentration of 50% for cryoprotection

  • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For storage solutions, Tris/PBS-based buffers at pH 8.0 containing 6% trehalose have proven effective

It is strongly recommended to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity and activity .

How should UNQ5815/PRO19632 be reconstituted for experimental use?

For optimal reconstitution of lyophilized UNQ5815/PRO19632:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • For applications requiring different buffers, consider dialysis against your buffer of choice after initial reconstitution

  • If long-term storage of reconstituted protein is needed, add glycerol to 50% final concentration

  • Filter sterilize using a 0.22 μm filter if sterility is required for downstream applications

The protein should be handled on ice during reconstitution to minimize degradation, and reconstitution should be performed immediately before experimental use whenever possible .

What quality control methods should be used to verify recombinant UNQ5815/PRO19632 integrity?

Several complementary methods should be employed to verify protein integrity:

  • SDS-PAGE to confirm molecular weight and purity (typically >90% for research applications)

  • Western blotting using anti-His antibodies (if His-tagged) or specific antibodies against UNQ5815/PRO19632

  • Mass spectrometry to verify the exact mass and confirm the amino acid sequence

  • Size exclusion chromatography to assess aggregation state and homogeneity

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Dynamic light scattering (DLS) to assess protein monodispersity

What approaches can be used to determine the function of UNQ5815/PRO19632?

Determining the function of uncharacterized proteins requires a multifaceted approach:

  • Bioinformatic analysis:

    • Sequence homology comparisons across species

    • Protein domain prediction and conserved motif identification

    • Structural modeling and fold recognition

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

  • Cellular localization studies:

    • Fluorescent protein tagging and microscopy

    • Subcellular fractionation followed by Western blotting

    • Immunofluorescence with specific antibodies

  • Genetic approaches:

    • CRISPR-Cas9 knockout/knockdown followed by phenotypic analysis

    • Overexpression studies with functional readouts

    • Rescue experiments in knockout models

  • Biochemical characterization:

    • Enzymatic activity assays

    • Binding assays with potential substrates or partners

    • Structural studies (X-ray crystallography, cryo-EM, NMR)

How can researchers address threats to valid inference when studying UNQ5815/PRO19632?

When studying uncharacterized proteins like UNQ5815/PRO19632, several validity threats should be addressed:

  • Internal validity:

    • Implement rigorous blinding procedures in all subjective measurements

    • Include appropriate positive and negative controls in each experiment

    • Perform sample size calculations before experiments

    • Use randomization when allocating samples to treatment groups

    • Pre-register experimental protocols to avoid post-hoc adjustments

  • External validity:

    • Test hypotheses across multiple cell lines and model systems

    • Validate results using complementary methodological approaches

    • Consider species differences when translating findings

    • Evaluate protein function under various physiological conditions

  • Construct validity:

    • Ensure protein constructs maintain native folding and function

    • Validate antibody specificity using knockout controls

    • Consider tag position effects on protein function

    • Report drug exposure (serum measurements) rather than just dosage

  • Statistical approaches:

    • Use appropriate statistical tests for data distribution

    • Correct for multiple comparisons

    • Report effect sizes alongside p-values

    • Consider publication bias in meta-analyses

What bioinformatic approaches are most useful for predicting potential functions of UNQ5815/PRO19632?

Given the uncharacterized nature of UNQ5815/PRO19632, bioinformatic analyses provide valuable initial insights:

  • Sequence-based analyses:

    • BLAST and PSI-BLAST for identifying remote homologs

    • Multiple sequence alignment to identify conserved residues

    • Motif scanning using PROSITE, PFAM, and InterPro databases

    • Signal peptide prediction (SignalP) and transmembrane domain prediction (TMHMM)

    • Post-translational modification site prediction

  • Structure-based analyses:

    • Ab initio protein structure prediction (AlphaFold2, RoseTTAFold)

    • Template-based modeling using homologous proteins

    • Molecular dynamics simulations to study conformational flexibility

    • Protein-protein docking simulations with potential partners

    • Binding site prediction tools (CASTp, SiteMap)

  • Network-based analyses:

    • Gene co-expression network analysis

    • Protein-protein interaction network prediction

    • Gene ontology enrichment of predicted interactors

    • Pathway enrichment analysis

    • Disease association prediction

  • Integrative approaches:

    • Combined text mining and data integration platforms

    • Automated function prediction tools (SIFTER, PANNZER)

    • Cross-species conservation analysis

A comprehensive bioinformatic workflow integrating these approaches provides testable hypotheses about UNQ5815/PRO19632 function that can guide subsequent experimental validation .

What cell-based assays are appropriate for investigating the cellular localization and potential function of UNQ5815/PRO19632?

Cell-based assays provide crucial insights into protein function within the cellular context:

  • Subcellular localization assays:

    • C-terminal and N-terminal GFP/RFP fusion expression

    • Colocalization with organelle markers (ER, Golgi, plasma membrane)

    • Fractionation followed by Western blotting

    • Super-resolution microscopy for detailed localization

  • Functional impact assays:

    • Overexpression phenotype analysis (morphology, proliferation, migration)

    • CRISPR knockout/knockdown with phenotypic screening

    • Rescue experiments with wild-type and mutant constructs

    • High-content screening for various cellular parameters

  • Interaction assays:

    • FRET/BRET to detect protein-protein interactions

    • Split-GFP complementation assays

    • Proximity labeling (BioID, APEX) in living cells

    • Immunoprecipitation followed by mass spectrometry

  • Signaling pathway analysis:

    • Reporter gene assays for major signaling pathways

    • Phosphoproteomic analysis upon perturbation

    • Transcriptomic analysis upon overexpression/knockout

  • Disease model assays:

    • Expression analysis in patient-derived cells

    • Phenotype rescue in disease models

    • Drug response modulation testing

These cell-based approaches should be conducted in relevant cell types that might naturally express UNQ5815/PRO19632 for physiologically meaningful results .

How can researchers validate antibodies for studying endogenous UNQ5815/PRO19632?

Antibody validation is crucial for reliable detection of uncharacterized proteins like UNQ5815/PRO19632:

  • Initial validation approaches:

    • Western blotting against recombinant protein as positive control

    • Testing antibody against multiple cell lines with varying expression levels

    • Peptide competition assays to confirm specificity

    • Cross-reactivity testing against closely related proteins

  • Critical specificity controls:

    • CRISPR knockout/knockdown cells as negative controls

    • Overexpression systems as positive controls

    • Immunoprecipitation followed by mass spectrometry to confirm target

    • Testing multiple antibodies against different epitopes of the same protein

  • Application-specific validation:

    • For immunohistochemistry: testing fixation conditions and antigen retrieval methods

    • For flow cytometry: comparison with isotype controls

    • For immunofluorescence: colocalization with tagged protein versions

    • For ChIP applications: testing sonication conditions and enrichment over IgG control

  • Documentation and reporting:

    • Record lot number and validation data

    • Document complete experimental conditions

    • Report negative results alongside positive findings

    • Consider antibody registry databases for standardization

What are the optimal experimental controls when studying UNQ5815/PRO19632?

Robust experimental design requires appropriate controls:

  • Positive controls:

    • Recombinant UNQ5815/PRO19632 protein with confirmed activity

    • Cell lines with confirmed high expression levels

    • Related proteins with known function for comparative studies

  • Negative controls:

    • CRISPR knockout cell lines lacking UNQ5815/PRO19632

    • siRNA/shRNA knockdown cells with validated reduction

    • Isotype-matched antibody controls for immunological applications

    • Empty vector transfections for overexpression studies

  • Technical controls:

    • Loading controls for Western blotting (β-actin, GAPDH)

    • Housekeeping genes for qPCR normalization

    • Vehicle-only treatments for drug studies

    • Mock immunoprecipitation with non-specific IgG

  • Biological replicates:

    • Independent biological samples rather than technical replicates

    • Validation across multiple cell lines or tissue sources

    • Replication in different experimental systems when possible

  • Quality control checks:

    • Protein quality assessment before experiments

    • Mycoplasma testing of cell lines

    • Cell line authentication

    • Reagent validation and documentation

Implementing these controls ensures that observed effects are specifically attributable to UNQ5815/PRO19632 rather than experimental artifacts .

How should researchers approach phosphorylation and other post-translational modification studies for UNQ5815/PRO19632?

Post-translational modifications (PTMs) often regulate protein function and can provide functional insights:

  • Prediction approaches:

    • Computational prediction of potential PTM sites

    • Evolutionary conservation analysis of predicted sites

    • Structural modeling to assess site accessibility

  • Detection methodologies:

    • Phospho-specific antibodies for common modifications

    • Mass spectrometry for global PTM identification

    • Phos-tag gels for mobility shift detection

    • Radioactive labeling for highly sensitive detection

  • Functional validation:

    • Site-directed mutagenesis of predicted PTM sites

    • Pharmacological inhibition of specific modifying enzymes

    • In vitro modification assays with purified enzymes

    • Temporal dynamics analysis during cellular processes

  • Regulatory enzyme identification:

    • Co-immunoprecipitation with candidate modifying enzymes

    • Kinase/phosphatase inhibitor screens

    • Enzyme overexpression/knockdown effects

    • Proximity labeling to identify modifying enzymes

  • Physiological significance:

    • Stimulation experiments to trigger specific signaling pathways

    • Cell cycle synchronization for temporal regulation

    • Stress conditions to induce adaptive modifications

    • Disease model comparison for pathological alterations

PTM studies require careful sample handling to prevent artifact introduction and should include appropriate controls to distinguish specific from non-specific modifications .

How can researchers determine if UNQ5815/PRO19632 is part of a larger protein complex?

Investigating protein complex formation requires specialized approaches:

  • Biochemical separation techniques:

    • Size exclusion chromatography to determine native molecular weight

    • Blue native PAGE to preserve native complexes during separation

    • Sucrose gradient ultracentrifugation for complex fractionation

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Affinity-based approaches:

    • Tandem affinity purification (TAP-tagging)

    • Co-immunoprecipitation followed by Western blotting or mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • APEX2-based proximity labeling

  • Imaging-based methods:

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Three-hybrid systems for complex detection

    • Super-resolution co-localization studies

  • Biophysical techniques:

    • Analytical ultracentrifugation

    • Multi-angle light scattering (MALS)

    • Surface plasmon resonance (SPR) for interaction kinetics

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

  • Computational prediction:

    • Co-evolution analysis across species

    • Protein-protein docking simulations

    • Network analysis of potential interaction partners

These complementary approaches provide converging evidence for the integration of UNQ5815/PRO19632 into specific protein complexes, which may reveal functional insights .

What approaches are most effective for studying membrane-associated proteins like UNQ5815/PRO19632?

Membrane-associated proteins present unique experimental challenges:

  • Solubilization strategies:

    • Detergent screening (mild non-ionic, zwitterionic, ionic)

    • Detergent-free methods (nanodiscs, SMALPs)

    • Amphipol stabilization for structural studies

    • Reconstitution into liposomes or proteoliposomes

  • Expression and purification considerations:

    • Membrane fraction preparation protocols

    • Use of specialized E. coli strains (C41/C43) for membrane proteins

    • Insect or mammalian expression systems for complex membrane proteins

    • Optimized affinity tags for membrane protein purification

  • Structural biology approaches:

    • Cryo-electron microscopy

    • Lipid cubic phase crystallization

    • Solid-state NMR spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry

  • Functional assays:

    • Proteoliposome-based transport assays

    • GUV-based fluorescence assays

    • Electrophysiological measurements for channels

    • FRET-based conformational change detection

  • Topological analysis:

    • Protease protection assays

    • Glycosylation site mapping

    • Cysteine accessibility methods

    • Fluorescence quenching approaches

These specialized techniques overcome traditional limitations in membrane protein research and provide insights into the structure-function relationships of UNQ5815/PRO19632 .

How can researchers integrate multi-omics data to understand UNQ5815/PRO19632 function?

Multi-omics integration provides a comprehensive view of protein function:

  • Data types to integrate:

    • Transcriptomic data (RNA-seq, microarrays)

    • Proteomic data (expression, interactome)

    • Phosphoproteomic and other PTM data

    • Metabolomic profiles after perturbation

    • Genomic data (variants, GWAS associations)

  • Integration methods:

    • Correlation network analysis

    • Bayesian network modeling

    • Machine learning classification approaches

    • Pathway and gene set enrichment analysis

    • Causal reasoning algorithms

  • Time-course experiments:

    • Temporal dynamics after perturbation

    • Cell cycle-dependent changes

    • Differentiation or development trajectories

    • Response to environmental stimuli over time

  • Single-cell approaches:

    • scRNA-seq with protein perturbation

    • Spatial transcriptomics with protein localization

    • CyTOF for protein expression in heterogeneous populations

    • Live cell tracking with reporter systems

  • Visualization tools:

    • Heatmaps and clustering for pattern identification

    • Network visualization software

    • Dimensionality reduction techniques (PCA, t-SNE, UMAP)

    • Trajectory inference methods

Multi-omics integration provides a systems-level understanding of UNQ5815/PRO19632 function within cellular pathways and processes .

What statistical considerations should be applied when analyzing UNQ5815/PRO19632 experimental data?

  • Experimental design planning:

    • Power analysis for sample size determination

    • Randomization strategies to minimize bias

    • Blocking and stratification when appropriate

    • Pre-registration of analysis plans

  • Data preprocessing:

    • Outlier detection and handling

    • Normality testing and appropriate transformations

    • Batch effect correction

    • Missing data imputation considerations

  • Statistical testing:

    • Selection of parametric vs. non-parametric tests

    • Multiple testing correction (FDR, Bonferroni)

    • Effect size calculation alongside p-values

    • Confidence interval reporting

  • Advanced modeling:

    • Mixed-effects models for nested designs

    • ANOVA and ANCOVA for multiple factors

    • Regression approaches for continuous predictors

    • Survival analysis for time-to-event data

  • Reproducibility considerations:

    • Cross-validation approaches

    • Bootstrap resampling for robustness

    • Independent dataset validation

    • Publication of negative results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.