Recombinant Human Radiation-inducible immediate-early gene IEX-1 (IER3)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

IER3 is a multifunctional protein involved in:

A. ERK Signaling Pathway Regulation

  • Inhibits dephosphorylation of ERK1/2 by PP2A-PPP2R5C phosphatase, prolonging ERK activity .

  • Phosphorylation by ERK1/2 enhances its anti-apoptotic activity .

B. Apoptosis Modulation

  • Promotes survival under stress (e.g., radiation, TNF-α) by interacting with Mcl-1 to regulate nuclear translocation during DNA damage .

  • Induces apoptosis in cervical cancer cells via TAp73β-dependent pathways .

C. Clinical Relevance

  • Overexpressed in pancreatic ductal adenocarcinoma, conferring resistance to gemcitabine and starvation .

  • Rearrangements or dysregulation linked to myelodysplastic syndromes (MDS) and leukemia progression .

Table 1: Selected Studies on Recombinant IER3

Study FocusKey FindingsSource
ERK-IER3 InteractionIER3 phosphorylation by ERK enhances survival; IER3 amplifies ERK activation
Cervical Cancer ApoptosisTAp73β-induced IER3 mediates etoposide chemosensitivity in HPV+ cells
DNA Damage ResponseIER3 controls Mcl-1 nuclear accumulation post-irradiation
Hematopoietic DysfunctionIER3 deficiency causes thrombocytopenia and dysplastic bone marrow in mice

Applications in Research

  • Antibody Validation: Used as a control fragment (e.g., aa 1–41) for blocking experiments .

  • Mechanistic Studies: Investigated in ERK signaling, apoptosis assays, and cancer therapy resistance models .

  • Therapeutic Targeting: Explored for sensitizing tumors to chemotherapy by modulating IER3 expression .

Clinical and Pathological Implications

  • Cancer: Acts as a double-edged sword—pro-apoptotic in cervical cancer but pro-survival in pancreatic cancer .

  • Hematology: Reduced IER3 expression in MDS correlates with hematopoietic stem cell apoptosis and dysplasia .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. Should dry ice shipping be required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
IER3; DIF2; IEX1; PRG1; Radiation-inducible immediate-early gene IEX-1; Differentiation-dependent gene 2 protein; Protein DIF-2; Immediate early protein GLY96; Immediate early response 3 protein; PACAP-responsive gene 1 protein; Protein PRG1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
Uniprot No.

Target Background

Function
IER3 may play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. It also functions as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, IER3 may provide pancreatic ductal adenocarcinoma with notable resistance to cellular stresses, such as starvation or gemcitabine treatment.
Gene References Into Functions
  1. Our findings suggest, for the first time, that increased expression of IER3 protein may promote the aggressive progression of BCa. Notably, IER3 could be a potential prognostic marker for BCa patients. PMID: 30249226
  2. We identified the molecular mechanism responsible for IER3 degradation, involving a ternary complex of IER3, MDM2, and FHL2, which may contribute to cervical tumor growth. Furthermore, we demonstrated that FHL2 serves as a scaffold for E3 ligase and its substrate during the ubiquitination reaction, a function previously unreported for this protein. PMID: 26973248
  3. Analysis of consensus EGR-binding elements (EBEs) indicated that the immediate early response 3 gene (IER3) is a novel transcriptional target gene of EGR2, as confirmed by luciferase assay, electrophoretic mobility-shift assay (EMSA), chromatin immunoprecipitation (ChIP), and western blot analysis. PMID: 27890615
  4. This study characterized IEX-1's expression and function in rheumatoid arthritis synovial fibroblasts, revealing that IEX-1 is highly expressed in RA-SFs and negatively regulates RA-SF activation. PMID: 27736946
  5. Interleukin-1beta (IL-1beta)-induced IER3 expression is mediated by the ERK1/2 target, transcription factor Elk-1. PMID: 25066273
  6. Our findings suggest that IER3 is a potential tumor suppressor in the cervix, and the c-Ab1/p73beta/IER3 axis represents a novel and crucial signaling pathway conferring etoposide chemosensitivity. PMID: 25666857
  7. High expression of IER3 is associated with hepatocarcinoma. PMID: 25684507
  8. In human samples extracted from failed AVF, there was a significant increase in IEX-1 expression localized to the adventitia. PMID: 25036043
  9. IEX-1 expression levels correlate with the severity of preeclampsia. PMID: 23725081
  10. We investigated the binding effect of hcmv-miR-UL148D to the 3' untranslated region (3'UTR) of IEX-1. Results revealed that only one binding site in the 3'UTR of IEX-1 was completely complementary to an 11nt sequence in the 5' terminus of hcmv-mir-UL148D. PMID: 23403649
  11. The interference of IER3 with the PI3K/Akt-Fyn pathway represents a novel mechanism of Nrf2 regulation that may be disrupted in tumors, through which IER3 exerts its stress-adaptive and tumor-suppressive activity. PMID: 24311782
  12. IEX-1 plays a role in the suppression of apoptosis and protects cells by controlling sensitivity to TNFalpha under both normal and inflammatory conditions. PMID: 21250941
  13. Altered IEX-1 expression could potentially serve as a novel predictor of malignant transformation and a prognostic indicator for cancer therapy. PMID: 22085302
  14. Changes in the methylation status of the IEX-1 promoter CpG island correlate with hematologic malignancies. PMID: 21518511
  15. IER3 plays a complex and, to some extent, contradictory role in cell cycle control and apoptosis. The effects of IER3 are linked to its interference with certain signaling pathways. PMID: 21112119
  16. IER3 is upregulated in human PDLCs subjected to tensile stress related to mechano-induced cell cycle arrest. PMID: 20934684
  17. Results suggest that hypertension in IEX-1 knockout mice may arise primarily from impaired cAMP signaling induced by overproduction of mitochondrial reactive oxygen species in vascular smooth muscle cells. PMID: 20713914
  18. Impaired apoptosis, extended duration of immune responses, and a lupus-like autoimmune disease in IEX-1-transgenic mice. PMID: 11782530
  19. Regulation by p53 tumor suppressor and Sp1 PMID: 11844788
  20. Mechanical strain increased IEX-1 gene expression in macrophages. PMID: 11910304
  21. Characterization of a novel hexameric repeat DNA sequence in the promoter of the immediate early gene, IEX-1, that mediates 1alpha,25-dihydroxyvitamin D(3)-associated IEX-1 gene repression. PMID: 12032839
  22. IEX-1 is a new type of ERK substrate that has a dual role in ERK signaling by acting both as an ERK downstream effector mediating survival and as a regulator of ERK activation. PMID: 12356731
  23. IEX-1 has roles in the regulation of cell death and oncogenesis [review]. PMID: 12510147
  24. Overexpression of IEX-1S results in acceleration of TNF-alpha-induced hepatocyte apoptosis through blockade of the PI3K/Akt survival pathway. PMID: 12682234
  25. The failure of IEX-1 to express its protein reflects the numerous mechanisms by which HSV-1 thwarts the cells from expressing its genes after infection. PMID: 12743274
  26. IEX-1 attenuates NF-kappaB activation, a possible counter-regulatory process leading to apoptosis. PMID: 12761504
  27. IEX-1 expression was stimulated by hydroxytamoxifen, with the degree of increase being greater in resistant cells (four-fold versus 1.5-fold) and this hydroxytamoxifen regulation being estrogen receptor dependent. PMID: 15120418
  28. Our data suggest that IEX-1 may regulate apoptosis by directly interacting with various proteins involved in the control of apoptotic pathways. PMID: 15451437
  29. We concluded that IEX-1 mRNA is not preferentially degraded during HSV-1 infection and that HSV-1 instead inhibits the normal turnover of this mRNA. PMID: 15767410
  30. We found that p73beta targets the apoptotic program at multiple levels: facilitating caspase activation through p53-dependent signals and inducing p57KIP2, while down-regulating c-IPA1 and IEX1 through a p53-independent mechanism. PMID: 15781630
  31. IEX-1 is organized in subnuclear structures and partially co-localizes with promyelocytic leukemia protein in HeLa cells. PMID: 15855159
  32. Sequence-targeting mutagenesis reveals a transmembrane-like integrated region of the protein that is critical for both pro-apoptotic and anti-apoptotic functions. PMID: 16567805
  33. IEX-1 plays a significant role in astrocytic differentiation of human glioma cells and functions downstream of PKA. PMID: 16960879
  34. ICP27 is essential for IEX-1 mRNA stabilization, while virion host shut plays little, if any, role. PMID: 16973576
  35. IER3 modulates NF-kappaB-dependent antiapoptotic protection, thereby exhibiting tumor-suppressive potential. PMID: 17704804
  36. This study suggests that evaluation of IEX-1 expression may be clinically valuable for predicting patient prognosis in pancreatic cancer. PMID: 18026799
  37. The study showed that IEX-1 is involved in the radiation-induced apoptosis of human glioma cells and that its overexpression enhances the apoptotic sensitivity of these cells to gamma-radiation. PMID: 18564103
  38. Down-regulation of the IEX-1 gene was associated with short survival in myelodysplastic syndrome patients. PMID: 19152102
  39. This study demonstrated the physical association of the MCL-1 and IEX-1 proteins, the modulatory role of MCL-1 in IEX-1-induced apoptosis, and the role of BIM as an essential downstream molecule for IEX-1-induced cell death. PMID: 19285955
  40. The small interfering RNA knockdown of BNIP3, IER3, and SEPW1 genes affected critical multiple myeloma endothelial cell functions correlated with the overangiogenic phenotype. PMID: 19690192
  41. Results suggest dysregulated expression of IER3 is common in MDS (61% >4-fold increase or decrease in expression with decreased expression primarily in early MDS and increased expression primarily in later MDS progressing toward leukemia). PMID: 19773435

Show More

Hide All

Database Links

HGNC: 5392

OMIM: 602996

KEGG: hsa:8870

STRING: 9606.ENSP00000259874

UniGene: Hs.730861

Protein Families
IER3 family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is IER3 and what are its alternative nomenclatures?

Immediate early response gene 3 (IER3) is a stress-inducible gene that is rapidly regulated by multiple factors, including transcription factors, inflammatory cytokines, viral infection, chemical carcinogens, growth factors, and hormones. It is also known by several alternative names including IEX-1, Dif-2, gly96, and p22/PRG-1. The gene belongs to the immediate early response gene family, which is characterized by rapid transcriptional activation without requiring de novo protein synthesis .

What are the basic biological functions of IER3?

IER3 exerts diverse effects in regulating cell apoptosis and cell cycle progression through its distinct domains. It plays crucial roles in cellular stress responses and can function either as an oncogene or a tumor suppressor in a context-dependent manner. IER3 is involved in modulating key signaling pathways, including Nuclear Factor kappa B (NF-κB) and Mitogen-Activated Protein Kinase (MAPK)/Extracellular Regulated Protein Kinases (ERK) pathways, which influence various cellular processes like proliferation, differentiation, and apoptosis .

What is unique about the expression kinetics of IER3?

As a member of the immediate early response gene family, IER3 exhibits distinctive expression kinetics. Upon stimulation, it can be transcribed and activated within minutes, with peak expression typically reached within 15-20 minutes, without requiring new protein synthesis. This rapid response mechanism allows cells to promptly react to various stressors and environmental changes, making IER3 an essential component of the immediate cellular stress response system .

How should researchers design experiments to study IER3 expression in cancer tissues?

When designing experiments to study IER3 expression in cancer tissues, researchers should follow a systematic approach using the PICO framework (Patient/population, Intervention, Comparison, Outcome). First, clearly define the patient/population characteristics including cancer type, stage, and relevant demographics. Second, determine the specific experimental methods for evaluating IER3 expression, such as immunohistochemistry (IHC), RNA-sequencing (RNA-seq), or microarray analysis. Third, establish appropriate control groups, including normal adjacent tissue or healthy tissue from non-cancer subjects. Finally, define clear outcome measures, such as expression levels, subcellular localization, or correlation with clinicopathological features .

What methodologies are most effective for measuring IER3 expression in clinical samples?

Multiple complementary methodologies should be employed for comprehensive analysis of IER3 expression:

  • Immunohistochemistry (IHC): Provides information on protein expression levels and subcellular localization in tissue samples.

  • RNA-sequencing (RNA-seq): Offers quantitative measurement of IER3 mRNA expression across the entire transcriptome.

  • Microarray analysis: Allows simultaneous measurement of IER3 expression alongside thousands of other genes.

  • Quantitative PCR (qPCR): Provides sensitive and specific quantification of IER3 mRNA levels.

The combination of these methods strengthens the validity of findings through methodological triangulation. Statistical analyses should include standardized mean difference (SMD) calculations to compare expression levels between cancer and control groups, and survival analyses using Kaplan-Meier curves to evaluate prognostic significance .

How can researchers ensure the reliability and reproducibility of IER3 expression data?

To ensure reliability and reproducibility when studying IER3 expression:

  • Use multiple technical and biological replicates to account for variability.

  • Employ appropriate positive and negative controls for each experimental method.

  • Validate findings using at least two independent methodologies (e.g., IHC and RNA-seq).

  • Apply standardized protocols and scoring systems for IHC evaluation.

  • Utilize appropriate statistical methods to analyze data, including tests for heterogeneity (I² statistic) between studies.

  • Document detailed methodological information including antibody specifications, RNA extraction protocols, and analysis parameters.

  • Follow the FINER criteria (Feasible, Interesting, Novel, Ethical, Relevant) when designing research questions to ensure scientific rigor .

How does IER3 interact with the NF-κB signaling pathway?

IER3 exhibits complex regulatory interactions with the NF-κB signaling pathway, serving as both a target gene and a modulator of this pathway. The relationship is bidirectional: NF-κB activation can induce IER3 expression, while IER3 can subsequently regulate NF-κB activity through feedback mechanisms. The specific effects of IER3 on NF-κB signaling appear to be context-dependent and may vary across different cell types and under different cellular conditions. Understanding these interactions requires carefully designed experiments that can track both the activation state of NF-κB components and IER3 expression levels simultaneously .

What is the relationship between IER3 and the MAPK/ERK pathway?

IER3 plays a significant role in modulating the MAPK/ERK pathway. Research has shown that ERK activation leads to IER3 phosphorylation. Once phosphorylated, IER3 (p-IER3) enhances ERK phosphorylation by preventing its dephosphorylation via inhibition of B56-containing PP2A (a phosphatase). This creates a positive feedback loop that sustains ERK1/2 activation. This mechanism has been implicated in tumor development in several cancers, including pancreatic cancer, lung adenocarcinoma, and Hodgkin lymphoma. Experimental approaches to study this relationship should include phosphorylation-specific antibodies, pharmacological inhibitors of the MAPK pathway, and genetic manipulation of IER3 expression .

How can researchers experimentally distinguish between the oncogenic and tumor-suppressive functions of IER3?

To experimentally distinguish between oncogenic and tumor-suppressive functions of IER3, researchers should implement a multi-faceted approach:

  • Cell type-specific analysis: Compare IER3 functions across different cell types within the same cancer and across different cancer types.

  • Genetic manipulation: Use both overexpression and knockdown/knockout models to observe opposing phenotypes.

  • Pathway analysis: Examine the activation status of key signaling pathways (NF-κB, MAPK/ERK) following IER3 modulation.

  • Functional assays: Assess proliferation, apoptosis, migration, invasion, and colony formation capabilities.

  • In vivo models: Use xenograft and transgenic animal models to confirm in vitro findings.

  • Clinical correlation: Analyze patient data to correlate IER3 expression with survival outcomes and clinicopathological features.

This comprehensive approach can help resolve the seemingly contradictory functions of IER3 across different cancer contexts .

How does IER3 expression correlate with clinicopathological features in different cancer types?

IER3 expression correlates with various clinicopathological features across different cancer types, but these correlations are cancer-specific. For example, in bladder cancer, high IER3 expression has been significantly associated with lymph node metastasis (pN status), with 50% of high-IER3 expression cases showing positive lymph nodes compared to only 23.3% in low-expression cases (p=0.018). The correlation with other parameters like tumor stage (pT), lymphovascular invasion (LVI), and patient demographics (age, gender) varies between cancer types. In hepatocellular carcinoma (HCC), IER3 expression is related to tumor progression, though the specific clinicopathological correlations need further investigation .

ParameterIER3 (low)IER3 (high)P value
Number of patients49 (55.7%)39 (44.3%)-
Gender0.799
Female12 (24.5%)8 (20.5%)
Male37 (75.5%)31 (79.5%)
Age at Surgery (median, IQR)70 (62-75)72 (62-80)0.462
pT stage0.493
≤pT216 (32.7%)10 (25.6%)
≥pT333 (67.3%)29 (74.4%)
pN status0.018
pN(-)33 (76.7%)18 (50.0%)
pN(+)10 (23.3%)18 (50.0%)
LVI0.284
LVI(-)31 (63.3%)20 (51.3%)

How can researchers investigate the mechanistic role of IER3 in cancer progression?

To investigate the mechanistic role of IER3 in cancer progression, researchers should employ a comprehensive approach:

  • Gene expression profiling: Identify differentially expressed genes (DEGs) and co-expressed genes (CEGs) associated with IER3 in cancer tissues.

  • Functional annotation: Use Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses to determine biological processes, cellular components, and molecular functions associated with IER3-related genes.

  • Gene Set Enrichment Analysis (GSEA): Sort genes according to logFC values to identify enriched pathways and biological processes.

  • Protein-protein interaction analysis: Identify proteins that directly interact with IER3 to form functional complexes.

  • Transcriptional regulation: Identify transcription factors (TFs) that regulate IER3 expression using tools like hTFtarget and JASPAR.

  • Chromatin immunoprecipitation (ChIP): Confirm binding of predicted TFs to the IER3 promoter region.

  • Functional validation: Use cell-based assays with genetic manipulation of IER3 to validate predicted mechanisms .

What are the challenges in studying the phosphorylation dynamics of IER3?

Studying IER3 phosphorylation dynamics presents several significant challenges:

  • Rapid turnover: IER3 has a short half-life (approximately 30 minutes), making it difficult to capture the phosphorylation state at specific time points.

  • Multiple phosphorylation sites: IER3 can be phosphorylated at different residues, each potentially having distinct functional consequences.

  • Context-dependence: The phosphorylation patterns may vary across different cell types and stimulation conditions.

  • Technical limitations: Detection of phosphorylated IER3 requires phospho-specific antibodies, which may have varying sensitivity and specificity.

To overcome these challenges, researchers should consider using phosphorylation site mutants, phospho-mimetic substitutions, mass spectrometry-based phosphoproteomics, and real-time monitoring systems .

How can researchers resolve contradictory findings about IER3 function across different studies?

To resolve contradictory findings about IER3 function:

  • Standardize experimental conditions: Use identical cell lines, reagents, and protocols to minimize methodological variations.

  • Consider context-dependency: Acknowledge that IER3 functions may genuinely differ across cellular contexts, cancer types, and experimental conditions.

  • Examine genetic background: Analyze the mutational landscape and genetic alterations that might influence IER3 function.

  • Verify antibody specificity: Use multiple antibodies targeting different epitopes and validate with genetic knockdown controls.

  • Meta-analysis approach: Systematically compare outcomes across studies using standardized metrics and statistical methods.

  • Collaborations: Establish multi-laboratory collaborations to independently verify key findings.

  • Single-cell analysis: Investigate IER3 function at the single-cell level to account for cellular heterogeneity .

What novel methodologies can be applied to understand the temporal dynamics of IER3 activation?

To understand the temporal dynamics of IER3 activation, researchers can apply several innovative methodologies:

  • Live-cell imaging: Use fluorescent protein-tagged IER3 to monitor its subcellular localization and expression levels in real-time.

  • CRISPR-based transcriptional reporters: Develop systems that allow visualization of IER3 transcriptional activity in living cells.

  • Time-resolved proteomics: Apply pulsed SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to track IER3 protein synthesis and degradation rates.

  • Single-molecule RNA FISH (fluorescence in situ hybridization): Detect individual IER3 mRNA molecules with temporal resolution.

  • Microfluidic devices: Control the timing and dosage of stimuli while monitoring cellular responses.

  • Optogenetic tools: Use light-controlled systems to activate or inhibit IER3-related pathways with precise temporal control.

  • Mathematical modeling: Develop computational models that can predict the dynamic behavior of IER3 in response to various stimuli .

How should researchers identify and validate transcription factors that regulate IER3 expression?

To identify and validate transcription factors (TFs) that regulate IER3 expression, researchers should follow a systematic approach:

  • In silico prediction: Use bioinformatic tools such as hTFtarget to predict potential TFs that bind to the IER3 promoter.

  • Binding site analysis: Employ JASPAR to forecast binding sites of TFs within the IER3 promoter region.

  • Chromatin analysis: Utilize Cistrome DB and Integrative Genomics Viewer (IGV) to determine whether TF peaks are present in the IER3 transcription initiation site.

  • Experimental validation:

    • Perform chromatin immunoprecipitation (ChIP) to confirm TF binding to the IER3 promoter

    • Use reporter gene assays with wild-type and mutated IER3 promoter constructs

    • Apply electrophoretic mobility shift assays (EMSA) to verify direct binding

    • Manipulate TF expression and measure corresponding changes in IER3 levels

  • Functional correlation: Analyze whether the expression patterns of predicted TFs correlate with IER3 expression in clinical samples and experimental models .

What is the role of epigenetic mechanisms in regulating IER3 expression?

While the provided search results don't specifically address epigenetic regulation of IER3, researchers investigating this aspect should consider:

  • DNA methylation analysis: Examine the methylation status of CpG islands in the IER3 promoter region using bisulfite sequencing or methylation-specific PCR.

  • Histone modifications: Investigate active (H3K4me3, H3K27ac) and repressive (H3K27me3, H3K9me3) histone marks at the IER3 locus using ChIP-seq.

  • Chromatin accessibility: Assess chromatin structure at the IER3 locus using techniques like ATAC-seq or DNase-seq.

  • Non-coding RNAs: Explore the potential regulation of IER3 by microRNAs or long non-coding RNAs.

  • Epigenetic drugs: Test the effects of HDAC inhibitors, DNA methyltransferase inhibitors, and other epigenetic modulators on IER3 expression.

These approaches can provide insights into how epigenetic mechanisms contribute to the context-dependent expression of IER3 in different cellular environments.

How can the IER3 promoter region be characterized for research purposes?

Comprehensive characterization of the IER3 promoter region involves:

  • Sequence analysis: Identify conserved elements, CpG islands, and potential regulatory motifs.

  • Promoter truncation studies: Generate a series of deletion constructs to identify minimal promoter regions required for basal and inducible expression.

  • Site-directed mutagenesis: Systematically mutate predicted TF binding sites to determine their functional importance.

  • Enhancer identification: Use chromosome conformation capture techniques (3C, 4C, Hi-C) to identify distal regulatory elements that interact with the IER3 promoter.

  • Response element mapping: Determine specific elements required for response to various stimuli (radiation, growth factors, stress conditions).

  • Chromatin state assessment: Use ChIP-seq to map the distribution of histone modifications and chromatin-associated proteins across the locus.

  • CRISPR-based screening: Apply CRISPR activation/inhibition to systematically test the function of candidate regulatory elements .

What are the most promising therapeutic applications targeting IER3 in cancer treatment?

While the search results don't explicitly discuss therapeutic applications, researchers interested in targeting IER3 for cancer treatment should consider:

  • Pathway-specific interventions: Develop compounds that modulate IER3's interactions with key signaling pathways (NF-κB, MAPK/ERK) in a context-dependent manner.

  • Cancer-specific approaches: Design therapeutic strategies based on whether IER3 functions as an oncogene or tumor suppressor in the specific cancer type.

  • Combination therapies: Investigate how modulating IER3 might sensitize cancer cells to conventional chemotherapy or radiotherapy.

  • IER3-based biomarkers: Explore the potential of IER3 expression or phosphorylation status as predictive biomarkers for treatment response.

  • Targeted delivery: Develop methods to selectively deliver IER3-modulating agents to cancer cells while sparing normal tissues.

  • Synthetic lethality: Identify genetic or metabolic vulnerabilities created by altered IER3 expression that could be therapeutically exploited.

Researchers should design experiments to test these approaches using both in vitro models and appropriate in vivo systems.

How can single-cell analysis advance our understanding of IER3 function in heterogeneous tissues?

Single-cell analysis offers significant potential for understanding IER3 function in heterogeneous tissues:

  • Cell type-specific expression: Map IER3 expression patterns across different cell populations within tumors and their microenvironment.

  • Response heterogeneity: Identify differential responses to stimuli that induce IER3 expression at the single-cell level.

  • Trajectory analysis: Track the temporal dynamics of IER3 expression during cellular differentiation, stress response, or cancer progression.

  • Co-expression networks: Construct cell type-specific gene regulatory networks to understand the context-dependent functions of IER3.

  • Spatial transcriptomics: Integrate spatial information to understand how IER3 expression varies across different regions of a tumor.

  • Multi-omics integration: Combine single-cell transcriptomics with proteomics and epigenomics to generate comprehensive models of IER3 regulation and function.

These approaches can resolve contradictions in bulk tissue analyses and provide new insights into the complex roles of IER3 in normal and disease states.

What interdisciplinary approaches might yield novel insights into IER3 biology?

Advancing IER3 research requires innovative interdisciplinary approaches:

  • Systems biology: Develop computational models of IER3-related signaling networks to predict cellular responses to perturbations.

  • Structural biology: Determine the three-dimensional structure of IER3 protein and its complexes to understand functional mechanisms.

  • Chemical biology: Design small molecules that can modulate specific IER3 interactions or functions.

  • Synthetic biology: Create engineered cellular systems with customized IER3 regulatory circuits to study its function in controlled environments.

  • Immunology-oncology interface: Investigate how IER3 influences interactions between cancer cells and the immune system.

  • Radiobiology: Explore the role of IER3 in cellular responses to different types and doses of radiation.

  • Evolutionary biology: Analyze the conservation and divergence of IER3 function across species to identify fundamental versus specialized roles.

These interdisciplinary approaches can generate comprehensive insights that would not be possible through conventional single-discipline investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.