Recombinant Human Receptor activity-modifying protein 3 (RAMP3)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Human RAMP3

Recombinant Human Receptor Activity-Modifying Protein 3 (RAMP3) is a synthetic version of the native RAMP3 protein, engineered for research and therapeutic applications. Native RAMP3 is a 125-amino acid type I transmembrane glycoprotein that modulates G-protein-coupled receptor (GPCR) activity by altering ligand specificity and trafficking . Recombinant RAMP3 is produced in heterologous systems (e.g., E. coli, HEK 293 cells) to study receptor interactions, signaling pathways, and molecular mechanisms .

Domain Architecture

DomainAmino Acid RangeFunctionKey Interactions
Extracellular N-terminus24–118 (human)Binds ligands (e.g., adrenomedullin) and interacts with GPCRsCritical residues: 59–65 for AM binding
Transmembrane segmentSingle α-helixAnchors protein to membrane; mediates dimerization with GPCRsTM6/TM7 of secretin receptor
Intracellular C-terminus10 amino acidsRegulates trafficking and recycling via PDZ domain (e.g., NSF interaction) NSF binding for receptor resensitization

Recombinant RAMP3 retains these structural features, enabling functional studies of receptor complex formation and signaling .

Expression Systems

SystemPurityMolecular WeightApplicationsSource
E. coli>90%~13–50 kDaSDS-PAGE, Western blot, ligand-binding assays
HEK 293 cells>95%~25–50 kDaNative post-translational modifications
BaculovirusN/AN/AStructural studies (e.g., crystallography)

Key Modifications:

  • N-terminal His-tag (e.g., E. coli-expressed RAMP3): Facilitates nickel affinity chromatography .

  • Fc-chimera fusion: Enhances solubility and stability in mammalian systems .

Primary Interactions

GPCR PartnerLigandFunctionCitation
CALCRLAdrenomedullin (AM)Forms AM2R; regulates vasodilation, cardioprotection, and anti-inflammatory responses
CALCRAmylin (IAPP)Mediates glucose regulation and pancreatic β-cell survival
GPER1EstrogenReduces cardiac hypertrophy and fibrosis

Mechanistic Insights:

  • Trafficking: RAMP3 escorts CALCRL/GPER1 to the plasma membrane, bypassing intracellular retention .

  • Recycling: The PDZ domain in RAMP3 recruits NSF, enabling receptor resensitization post-internalization .

  • Competitive Binding: Overexpression of secretin receptor displaces RAMP3 from CALCRL, altering adrenomedullin responsiveness .

Experimental Uses

ApplicationMethodOutcomeCitation
Ligand bindingRadioligand assaysQuantify adrenomedullin/amylin binding affinity to RAMP3-GPCR complexes
Trafficking studiesFluorescence microscopyTrack RAMP3-CALCRL localization in live cells
Signaling pathwayscAMP/ERK assaysMeasure GPCR-mediated intracellular signaling cascades

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary by purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
RAMP3; Receptor activity-modifying protein 3; Calcitonin-receptor-like receptor activity-modifying protein 3; CRLR activity-modifying protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-148
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Uniprot No.

Target Background

Function

RAMP3 plays a crucial role in cardioprotection by mitigating cardiac hypertrophy and perivascular fibrosis via a GPER1-dependent mechanism. It facilitates the transport of the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane and functions as a receptor for adrenomedullin (AM) in conjunction with CALCRL.

Gene References Into Functions
Gene References and Associated Functions
  1. RAMP3 expression is downregulated in the fetal lung with increasing gestational age. PMID: 24169318
  2. The RAMP3 transmembrane domain is involved in the negative regulation of CLR/RAMP3 internalization. PMID: 22445753
  3. LOXL2 and RAMP3 exhibit strong co-expression in human colon, breast, and gastric carcinomas, but not in normal colon or gastric epithelial cells. PMID: 20802105
  4. This study elucidates the role of three specific amino acid changes in human RAMP3. PMID: 20034525
  5. Morphological fluorescence techniques, bioluminescence resonance energy transfer, and bimolecular fluorescence complementation analysis reveal that the secretin receptor specifically interacts with RAMP3, but not with RAMP1 or RAMP2. PMID: 19886671
  6. RAMP3 interacts with N-ethylmaleimide-sensitive factor, influencing trafficking. PMID: 15613468
  7. Using both endogenous and overexpressed cellular models, this study reveals a novel role for NHERF-1 and RAMP3 in adrenomedullin receptor internalization, suggesting additional regulatory mechanisms for receptor trafficking. PMID: 15805108
  8. Key RAMP3 residues involved in adrenomedullin receptor interactions are identified. PMID: 18593822
Database Links

HGNC: 9845

OMIM: 605155

KEGG: hsa:10268

STRING: 9606.ENSP00000242249

UniGene: Hs.25691

Protein Families
RAMP family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Moves from intracellular puncta to the plasma membrane in a RAMP3-dependent manner.
Tissue Specificity
Strongly expressed in lung, breast, immune system and fetal tissues.

Q&A

What is RAMP3 and how does it function in receptor biology?

Receptor Activity-Modifying Protein 3 (RAMP3) belongs to a family of three single-transmembrane proteins (RAMP1, RAMP2, and RAMP3) that interact with and modify the function of G Protein-Coupled Receptors (GPCRs). RAMP3 plays a critical role in modulating receptor trafficking, ligand specificity, and downstream signaling pathways. Unlike traditional receptor subunits, RAMPs act as accessory proteins that can dramatically alter the pharmacological properties of their partner receptors without being obligate components of receptor function .

Research has demonstrated that RAMP3 can influence receptor activity through multiple mechanisms. It can alter receptor trafficking to the cell surface, change ligand binding specificity, and modify G protein coupling preferences. In particular, RAMP3 has been shown to interact specifically with certain family B GPCRs, such as the secretin receptor and the glucagon-like peptide-1 receptor (GLP-1R), leading to altered signaling profiles and physiological outcomes .

How do researchers experimentally detect RAMP3-receptor interactions?

Several complementary methodologies have been developed to investigate RAMP3-receptor interactions:

  • Bioluminescence Resonance Energy Transfer (BRET): This technique allows for real-time monitoring of protein-protein interactions in living cells. For RAMP3 studies, researchers have utilized the NanoBiT system with LgBiT preceding the N-terminus of the receptor and SmBiT upstream of the N-terminus of the RAMP. When RAMP3 interacts with a receptor, the luciferase fragments come together to form a functional enzyme, generating measurable luminescence .

  • Bimolecular Fluorescence Complementation (BiFC): This approach involves splitting a fluorescent protein (such as YFP) into two non-fluorescent fragments and attaching them to potential interaction partners. When RAMP3 and its partner receptor interact, the fragments reconstitute to form a functional fluorophore .

  • Fluorescence Microscopy: Morphological fluorescence techniques using tagged constructs can visualize the co-localization of RAMP3 with receptors in cellular compartments .

  • Competition Binding Assays: NanoBRET competition binding assays can determine whether RAMP3 influences the binding affinity of various ligands to receptors. These assays typically use fluorescently labeled ligands (e.g., Ex-4-Red for GLP-1R) whose binding can be displaced by unlabeled competitors .

What is the evolutionary relationship between RAMP3 and other RAMPs?

Evolutionary analysis reveals interesting patterns in the relationships between different RAMPs and their GPCR partners:

  • RAMP1 and RAMP3 Coevolution: RAMP1 and RAMP3 show similar patterns of coevolution with GPCRs, suggesting potential functional redundancy. GPCRs that have high percentages of shared species with RAMP1 typically also have high percentages of shared species with RAMP3 .

  • RAMP2 Distinct Evolutionary Pattern: RAMP2 shows a significantly different evolutionary pattern compared to both RAMP1 and RAMP3. GPCRs that coevolved with RAMP2 are often distinct from those that coevolved with RAMP1 or RAMP3 .

  • Structural Resemblance: The evolutionary relationship is supported by structural similarities, with RAMP1 and RAMP3 showing resemblance in their extracellular regions, which is critical for receptor transport to the plasma membrane .

This evolutionary analysis provides insights into potential functional overlap between RAMP1 and RAMP3, while suggesting that RAMP2 may have evolved to serve distinct biological roles.

How does RAMP3 modulate GLP-1 receptor signaling and what are the implications for glucose homeostasis?

RAMP3 expression significantly alters the signaling profile of the GLP-1 receptor, with important implications for insulin secretion and glucose homeostasis:

Signaling Bias Effects:

  • cAMP Signaling: RAMP3 expression reduces GLP-1R-mediated cAMP accumulation, particularly at early time points (8 minutes). This effect is agonist-dependent, with reductions in both potency and efficacy observed for GLP-1, exendin-4, liraglutide, and oxyntomodulin when RAMP3 is overexpressed .

  • Calcium Mobilization: In contrast to its effects on cAMP, RAMP3 significantly enhances calcium mobilization in response to GLP-1. This enhancement is particularly pronounced, with the maximal response increasing from 67.7±8.3% to 131.7±3.8% of the ionomycin control when RAMP3 is overexpressed .

  • G Protein Coupling: RAMP3 expression reduces activation of the canonical Gαs pathway while increasing secondary couplings to Gαq and Gαi. This altered G protein coupling profile explains the shift from cAMP to calcium signaling .

Functional Consequences:
The RAMP3-induced signaling bias enhances glucose-stimulated insulin secretion. When cells overexpressing RAMP3 are stimulated with GLP-1, increased insulin secretion is observed compared to cells expressing GLP-1R alone. This enhancement appears to depend on the elevated calcium mobilization driven by increased Gαq and Gαi coupling .

These findings have significant implications for developing more effective GLP-1-based therapies for diabetes and obesity. By understanding and potentially targeting the GLP-1R-RAMP3 complex, researchers might develop agonists with improved signaling profiles that maximize beneficial effects while minimizing side effects such as gastrointestinal disruptions and pancreatitis .

What is the structural basis for RAMP3 interaction with GPCRs?

The structural determinants of RAMP3-GPCR interactions have been elucidated through various experimental approaches:

  • Transmembrane Domain Interactions: For the secretin receptor, RAMP3 association depends specifically on transmembrane helices 6 and 7 (TM6 and TM7) of the receptor. This interaction is highly selective, as the secretin receptor associates specifically with RAMP3 but not with RAMP1 or RAMP2 .

  • RAMP3 Structural Requirements: The intramembranous region of RAMP3 is critical for its association with GPCRs. Truncation constructs, particularly those lacking portions of this region, show impaired ability to interact with receptors .

  • Receptor Specificity: The structural basis for RAMP3 interaction appears to vary between different receptors. For example, while secretin receptor depends on TM6 and TM7, other receptors may utilize different interfaces. Chimeric receptor constructs (such as secretin-GLP1 receptor chimeras) have been used to map these interaction domains .

  • Stoichiometry Considerations: The optimal interaction between GLP-1R and RAMP3 occurs when RAMP3 is expressed at twice the level of GLP-1R (2:1 ratio by weight of expression plasmid). This suggests potential stoichiometric requirements that differ from the classical 1:1 ratio observed in some other RAMP-receptor pairs .

Understanding these structural determinants is crucial for rational drug design targeting specific RAMP-receptor complexes.

How does RAMP3 influence receptor trafficking and recycling?

RAMP3 plays a significant role in modulating receptor trafficking pathways:

Understanding these trafficking effects is important for predicting the pharmacological consequences of drugs targeting RAMP3-associated receptors.

What experimental controls should be included when studying RAMP3-receptor interactions?

When designing experiments to investigate RAMP3-receptor interactions, several critical controls should be included:

  • Expression Level Verification: Verification that RAMP3 and receptor expression levels are as intended. This can be accomplished through Western blotting or cell surface ELISA. For instance, when studying the effect of different RAMP3:receptor ratios, researchers should confirm that RAMP3 expression is indeed increased at the 2:1 ratio compared to 1:1 .

  • RAMP Specificity Controls: Include parallel experiments with RAMP1 and RAMP2 to confirm specificity of effects. This is particularly important given the structural similarities between RAMPs .

  • Empty Vector Controls: Cells transfected with empty vectors at equivalent DNA amounts should be used to control for non-specific effects of transfection.

  • Pharmacological Inhibitors: When dissecting signaling pathways, specific inhibitors should be employed. For example, YM-254890 (Gαq/11 inhibitor) and pertussis toxin (Gαi/o inhibitor) can help delineate the contributions of different G protein pathways to RAMP3-mediated effects .

  • RAMP3 Truncation/Mutation Controls: Include RAMP3 constructs with deleted or mutated domains to confirm the structural basis of interactions. For instance, the Δ(10-100) RAMP3 construct lacking 90 amino acids can help determine which regions are critical for interaction .

  • Ligand Controls: When studying signaling, include multiple agonists to identify agonist-dependent effects. The pattern of RAMP3 modulation may vary between endogenous agonists (GLP-1, oxyntomodulin), degradation products (GLP-1 9-36), and synthetic mimetics (exendin-4, liraglutide) .

How can researchers quantitatively analyze RAMP3-mediated signaling bias?

Quantitative analysis of signaling bias induced by RAMP3 requires sophisticated approaches:

  • Concentration-Response Curves: Generate complete concentration-response curves for multiple signaling pathways (e.g., cAMP accumulation, calcium mobilization) with and without RAMP3 expression. This allows calculation of potency (EC50) and efficacy (Emax) values for statistical comparison .

  • Time Course Experiments: Conduct measurements at multiple time points (e.g., 8 minutes and 30 minutes for cAMP) to capture temporal dynamics of signaling, as RAMP3 effects may be time-dependent .

  • Bias Calculation: Calculate bias factors using the operational model of agonism. This involves normalizing responses to a reference agonist and reference pathway to quantify the degree to which RAMP3 shifts signaling toward particular pathways .

  • Statistical Analysis: Apply appropriate statistical tests (typically ANOVA with post-hoc tests) to determine significance of differences in potency and efficacy across conditions.

  • Cellular Function Assays: Correlate signaling measurements with functional outcomes like insulin secretion to establish biological relevance of observed signaling changes .

Table 1: Example of Quantitative Analysis of RAMP3 Effects on GLP-1R Signaling

Signaling PathwayParameterGLP-1R AloneGLP-1R + RAMP3 (1:1)GLP-1R + RAMP3 (2:1)Statistical Significance
cAMP (8 min)pEC5011.4±0.3Not specified10.4±0.2p<0.05
cAMP (30 min)pEC50HigherNot specifiedLowerSignificant reduction
Ca2+ Mobilization% Max67.7±8.3Not specified131.7±3.8p<0.0001
Ca2+ Mobilization (GLP-1)pEC507.2±0.2Not specified8.1±0.2p<0.05

How might targeting the RAMP3-receptor interface lead to novel therapeutic approaches?

The RAMP3-receptor interface represents a promising target for developing novel therapeutics with enhanced specificity and reduced side effects:

What are the implications of RAMP3-receptor interactions for personalized medicine?

RAMP3-receptor interactions may have significant implications for personalized medicine approaches:

  • Genetic Variation: Polymorphisms in RAMP3 or its partner receptors could affect complex formation and function, potentially explaining variability in patient responses to certain drugs. Genetic screening could identify patients likely to respond differently to therapies targeting RAMP3-associated receptors.

  • Expression Level Biomarkers: Measuring RAMP3 expression levels in patient tissues could serve as a biomarker for predicting drug efficacy. Patients with higher RAMP3 expression might respond differently to GLP-1R agonists, for example .

  • Disease-Specific Considerations: Since RAMP3 modifies signaling in a way that enhances insulin secretion, its role in diabetes pathophysiology and treatment warrants further investigation. Patients with different diabetes subtypes might have varied RAMP3 expression patterns or functions .

  • Drug Development Strategy: When developing new GLP-1 mimetics or small molecule agonists and allosteric modulators for treating type 2 diabetes and obesity, considering RAMP expression is crucial. Agonists with reduced affinity for the RAMP3 complex might show reduced therapeutic potential in tissues expressing RAMP3 .

  • Combination Therapies: Understanding how RAMP3 modifies receptor function could inform rational combination therapy approaches, potentially allowing lower doses of individual agents with synergistic effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.