Recombinant Human Receptor expression-enhancing protein 1 (REEP1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Receptor Expression-Enhancing Protein 1 (REEP1) is a protein encoded by the REEP1 gene in humans . REEP1 belongs to the Receptor Expression Enhancing Protein (REEP) family, which comprises six members. REEP proteins were initially identified for their ability to enhance the expression of olfactory receptors and other G protein-coupled receptors (GPCRs) that are typically difficult to express .

Gene and Protein Structure

The REEP1 gene encodes a protein that participates in the functional activities of organelles, such as the interaction between the tubular endoplasmic reticulum (ER) and microtubules, and in peripheral ER shaping . The REEP1 protein includes a conserved TB2/DP1/HVA22 domain, which may have a chaperone-like function . Additionally, it contains a mitochondria-localization domain and a cytoplasmic C-terminus that interacts with microtubules . A highly conserved microRNA (miRNA) binding site is present in the 3' UTR of REEP1 mRNA, and pathogenic mutations in this region can affect its post-transcriptional regulation .

Expression and Localization

REEP1 is expressed in neuronal and neuronal-like exocytotic tissues . Within cells, REEP1 localizes to a unique vesicular compartment and may cycle between this compartment and the ER via atlastin-mediated fusion . REEP1 resides in the endoplasmic reticulum (ER) . Studies using monoclonal antibodies against REEP1 have confirmed its ER localization, showing a fine intracellular network similar to that of calreticulin, an ER-resident protein .

Function

REEP1 is involved in shaping the endoplasmic reticulum (ER) membrane and modulating the trafficking of specific G protein-coupled receptors (GPCRs) by affecting ER cargo capacity . REEP1-4 proteins induce membrane curvature and reside in a unique vesicular compartment . These vesicles contain atlastin-1, a membrane fusogen, and may regulate ER tubule dynamics .

Association with Disease

Mutations in REEP1 are linked to neurodegenerative disorders affecting upper and lower motor neurons, including hereditary spastic paraplegia (HSP) and distal hereditary motor neuropathy type V (dHMN-V) . Disruptions in the hairpin domain of REEP1 can impair ER organization in distal axons, potentially leading to the length-dependent degeneration of upper motor neurons observed in HSP . Approximately 60 pathogenic mutations in REEP1 have been reported, including missense mutations, nonsense mutations, exon deletions, splicing site mutations, and miRNA binding site mutations .

Research Findings

StudyFindings
Björk et al. (2013) REEP1, REEP2, and REEP6 are ER resident proteins.
Esteves et al. (2024) REEP1-4 reside in a unique vesicular compartment and generate vesicles by budding from the ER.
Goizet et al. (2008) Identified 13 novel and 2 known REEP1 mutations in patients with hereditary spastic paraplegia.
Park et al. (2010) REEP1 and REEP2 proteins are preferentially expressed in neuronal and neuronal-like exocytotic tissues.
Zhao et al. (2020) REEP1 mutations can disrupt the normal function of the hairpin domain, leading to pathogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
REEP1; C2orf23; SPG31; Receptor expression-enhancing protein 1; Spastic paraplegia 31 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
REEP1
Target Protein Sequence
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVH FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASG KHGQPKMSRSASESASSSGTA
Uniprot No.

Target Background

Function

REEP1 is essential for endoplasmic reticulum (ER) network formation, shaping, and remodeling. It connects ER tubules to the cytoskeleton and may enhance cell surface expression of odorant receptors. It may also play a role in long-term axonal maintenance.

Gene References Into Functions

Research supporting REEP1 function and associated disorders:

  • REEP1 gene mutations have been linked to hereditary spastic paraplegias. (PMID: 26671083)
  • REEP1 facilitates interactions between the endoplasmic reticulum and mitochondria; this function is impaired by disease-associated mutations. (PMID: 26201691)
  • Nonsense REEP1 variants causing haploinsufficiency/loss of function are responsible for autosomal dominant hereditary spastic paraplegia (HSP)-type SPG31. (PMID: 24986827)
  • Functional mutation analysis has revealed distinct pathomechanisms associated with REEP1 mutations, providing insights into its functions. (PMID: 24478229)
  • REEP1/REEP2 expression is largely confined to neuronal and neuronal-like exocytotic tissues, consistent with the neuronally restricted symptoms of REEP1 genetic disorders. (PMID: 24355597)
  • REEP1 is a neuron-specific, membrane-binding, membrane curvature-inducing protein residing in the endoplasmic reticulum. (PMID: 24051375)
  • A novel REEP1 mutation has been identified in patients with upper motor neuron syndrome. (PMID: 23108492)
  • Whole-exome sequencing revealed a splice-site alteration in REEP1 as a candidate variant. (PMID: 22703882)
  • Twelve different heterozygous REEP1 mutations, including two exon deletions, have been associated with pure or complex phenotypes. (PMID: 21618648)
  • Previously unreported autosomal dominant mutations in the REEP1 gene have been identified in hereditary spastic paraplegia. (PMID: 20718791)
  • Atlastin-1, spastin, and REEP1 interact within the tubular ER membrane in corticospinal neurons to coordinate ER shaping and microtubule dynamics. (PMID: 20200447)
  • REEP1 mutations are rare in Chinese Han patients with hereditary spastic paraplegia. (PMID: 19781397)
  • RTP and REEP gene expression has been observed in human circumvallate papillae and testis, sites of taste receptor gene expression. (PMID: 16720576)
  • REEP1 is widely expressed and localizes to mitochondria, highlighting the importance of mitochondrial function in neurodegenerative disease. (PMID: 16826527)
  • Thirteen novel and two known REEP1 mutations were identified in patients with autosomal dominant hereditary spastic paraplegia type SPG31. (PMID: 18321925)
  • Studies confirm the previously observed mutation range (3% to 6.5%) and expand the spectrum of REEP1 mutations. (PMID: 18644145)
  • Research has determined the frequency of REEP1 mutations in autosomal dominant HSP (ADHSP) and sporadic spastic paraparesis (SSP), analyzing the genotype/phenotype correlation. (PMID: 19034539)
  • A novel splice-site mutation (REEP1 c417+1g>a) was identified in a Chinese family with ADHSP. (PMID: 19072839)
Database Links

HGNC: 25786

OMIM: 609139

KEGG: hsa:65055

STRING: 9606.ENSP00000438346

UniGene: Hs.368884

Involvement In Disease
Spastic paraplegia 31, autosomal dominant (SPG31); Neuronopathy, distal hereditary motor, 5B (HMN5B)
Protein Families
DP1 family
Subcellular Location
Membrane. Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Tissue Specificity
Expressed in circumvallate papillae and testis.

Q&A

What is REEP1 and what is its cellular localization?

REEP1 (Receptor Expression-Enhancing Protein 1) is found in neurons in the brain and spinal cord. Unlike earlier conflicting reports identifying REEP1 as either an ER or mitochondrial protein, current research demonstrates that REEP1 is present at the ER-mitochondria interface and contains subdomains for both mitochondrial and ER localization .

The protein is part of the REEP family, with REEP1-4 residing in a unique vesicular compartment distinct from the bulk ER . Within this specialized cellular niche, REEP1 plays important structural and functional roles in maintaining ER morphology and facilitating interactions between cellular compartments.

Methodologically, localization studies typically employ fluorescence microscopy with tagged REEP1 constructs, subcellular fractionation techniques, and co-localization studies with known ER and mitochondrial markers to precisely determine its distribution.

What is the molecular structure and functional domains of REEP1?

REEP1 contains distinct functional subdomains that determine its localization and activity. Research has identified specific regions for mitochondrial targeting (amino acids 1-115) and ER localization (amino acids 116-201) . The protein contains transmembrane segments that are critical for its membrane-shaping properties.

Experimental approaches to study REEP1 domains include:

DomainAmino Acid PositionFunctionExperimental Approach
N-terminal domain1-115Mitochondrial targetingTruncation constructs, cellular localization studies
Central domain116-157Critical for ER interactionDeletion mutants, split-RLuc8 assay
C-terminal region116-201ER localizationGFP-tagged truncation constructs

Researchers typically employ site-directed mutagenesis and expression of truncated constructs to determine the functional significance of each domain . Advanced structural biology techniques including X-ray crystallography or cryo-EM would be required for more detailed structural analysis.

What genetic disorders are associated with REEP1 mutations?

REEP1 mutations are primarily associated with autosomal dominant hereditary spastic paraplegia (HSP) type SPG31 . Mutations in REEP1 account for approximately 3% of all HSP cases, but the frequency increases to 8.2% in pure HSP forms .

The clinical presentation typically involves progressive lower limb spasticity and weakness. While most patients present with a pure spastic paraplegia phenotype, some cases exhibit additional symptoms including peripheral nerve involvement .

Research methodologies for identifying REEP1-associated disorders include:

  • Whole exome sequencing for mutation identification

  • Multiplex ligation-dependent probe amplification (MLPA) to detect copy number variations

  • Segregation analysis in families with suspected hereditary disorders

  • Genotype-phenotype correlation studies to understand variable expressivity

How is REEP1 expression regulated in different tissue types?

REEP1 shows predominant expression in neurons of the brain and spinal cord . Within neurons, there is differential expression between axons, which contain primarily ER tubules, and dendrites and cell bodies, which contain a mixed morphology of tubules and sheets .

Methodological approaches to study REEP1 expression include:

  • qRT-PCR for quantitative mRNA expression analysis

  • Western blotting for protein expression levels

  • Immunohistochemistry for tissue and subcellular localization

  • In situ hybridization to visualize mRNA distribution in tissues

  • Single-cell RNA sequencing to assess cell-type specific expression patterns

Research indicates that REEP1 expression patterns correlate with its function in maintaining ER morphology in highly polarized cells like neurons, which may explain the selective vulnerability of long axons in REEP1-related disorders.

What are the molecular mechanisms of REEP1-mediated hereditary spastic paraplegia?

  • Most disease-causing mutations are small insertions, deletions, or splice site mutations that result in shifts of the open reading frame followed by premature termination of translation .

  • Copy number variations including large duplications have been identified in affected individuals .

  • Functional studies demonstrate that knockdown of REEP1 results in neuritic growth defects and degeneration, mimicking the pathological features of HSP .

The pathomechanism appears to involve disruption of ER-mitochondria interactions. Using a novel split-RLuc8 reassembly assay, researchers have demonstrated that REEP1 facilitates ER-mitochondrial interactions in live cells, and this function is abrogated by disease-associated mutations . This provides a direct link between altered ER-mitochondria communication and axonal degeneration in HSP.

Experimental models to study these mechanisms include:

  • Primary cortical neuron cultures from wild-type and REEP1-mutant mice

  • Patient-derived induced pluripotent stem cells differentiated into neurons

  • Drosophila and zebrafish models for in vivo studies

How do different REEP1 mutations correlate with clinical phenotypes?

Research has revealed interesting genotype-phenotype correlations in REEP1-related disorders. The distribution of age at onset suggests a bimodal pattern, with initial symptoms appearing either before age 20 or after age 30 .

Mutation TypeClinical PresentationAge of OnsetDisease Progression
Loss-of-function variantsPure spastic paraplegiaBimodal: <20 or >30 yearsVariable, often slower
Toxic gain-of-function variantsMixed phenotype (HSP + lower motor neuron disease)VariableOften more severe
c.337C>T (p.Arg113*)Reported with both phenotypesVariablePatient-dependent

This phenotypic variability suggests that genetic or environmental modifiers may influence disease expression, an area requiring further research.

What methodologies can be used to study REEP1-mediated ER-mitochondria interactions?

Several advanced methodologies have been developed to study the role of REEP1 in mediating ER-mitochondria interactions:

  • Split-RLuc8 reassembly assay: This novel technique allows researchers to measure ER-mitochondria interactions in live cells. The assay involves expressing the N-terminal fragment of Renilla luciferase (RLuc8) fused to a mitochondrial targeting sequence and the C-terminal fragment fused to an ER localization sequence. When mitochondria and ER are in close proximity, the fragments reassemble to produce luminescence .

  • Subcellular fractionation: To isolate mitochondria-associated membranes (MAMs), where REEP1 is localized. This technique involves differential centrifugation to separate pure mitochondria from ER-mitochondria contact sites.

  • Proximity ligation assays: To visualize and quantify interactions between REEP1 and proteins in different cellular compartments.

  • Live-cell imaging: With fluorescently tagged proteins to monitor ER-mitochondria contact dynamics.

  • Electron microscopy: To visualize ultrastructural changes in ER-mitochondria contacts in the presence of wild-type or mutant REEP1.

These methodologies have revealed that REEP1 facilitates ER-mitochondrial interactions, a function diminished by disease-associated mutations .

How do REEP1 and its family members contribute to endoplasmic reticulum morphology?

REEP1 belongs to a family of membrane curvature-inducing proteins that shape the endoplasmic reticulum. Research has revealed distinct functional differences between REEP family members:

  • REEP5 (and likely REEP6) shape the general ER tubular network and are abundantly expressed in most cells .

  • REEP1-4 form a distinct subfamily that generates a unique vesicular compartment by budding from the ER. These vesicles contain the membrane fusogen atlastin-1 but not general ER proteins .

Experimental approaches to study REEP contributions to ER morphology include:

  • Expression of wild-type and mutant REEP proteins in cell lines

  • Knockdown studies using siRNA or CRISPR-Cas9

  • Live-cell imaging with fluorescently tagged ER markers

  • Electron microscopy to visualize ER ultrastructure

Research has shown that mutations in REEP1-4 that compromise curvature generation, including those causing disease, relocalize the proteins to the bulk ER . These mutants interact with wild-type proteins to retain them in the ER, consistent with their autosomal-dominant disease inheritance pattern.

What experimental models are best suited for studying REEP1 function?

Several experimental models have been developed to study REEP1 function and dysfunction:

Model SystemAdvantagesLimitationsKey Applications
Primary cortical neuronsPhysiologically relevantLimited lifespan, species differencesNeuritic growth, degeneration assays
Patient-derived iPSCsHuman genetic backgroundVariability, complex differentiationDisease modeling, drug screening
Mouse modelsIn vivo system, genetic manipulationSpecies differences, costLong-term pathology, behavioral studies
Cell lines (HEK293, COS-7)Easy manipulation, high throughputNon-neuronal backgroundProtein interactions, localization studies
DrosophilaRapid generation time, genetic toolsEvolutionary distanceHigh-throughput screening, modifier studies
ZebrafishVertebrate model, transparencySome pathway differencesIn vivo imaging, developmental studies

When studying REEP1, primary cortical neurons have provided valuable insights into neuritic growth defects and degeneration induced by REEP1 knockdown or mutation . These models allow researchers to directly observe the effects of REEP1 dysfunction on neurons, the cell type most affected in HSP.

For genetic manipulations, researchers typically use site-directed mutagenesis to introduce specific mutations (such as P19R and A20E) that have been identified in patients . Additionally, RNA interference approaches using shRNA constructs have been employed to knockdown REEP1 expression.

What are the current challenges and future directions in REEP1 research?

Current challenges in REEP1 research include:

  • Incomplete understanding of normal function: While REEP1's role in ER morphology and ER-mitochondria interactions is established, its precise molecular mechanisms remain incompletely understood, particularly regarding its interactions with other proteins.

  • Therapeutic development: Despite understanding the genetic basis of REEP1-associated HSP, effective therapies are lacking. Developing therapeutic approaches that address the underlying molecular pathology is a major challenge.

  • Model systems limitations: Current model systems may not fully recapitulate the chronic, progressive nature of REEP1-related disorders that develop over decades in humans.

Future research directions should focus on:

  • Developing more physiologically relevant model systems, including human iPSC-derived neurons with controlled genetic backgrounds.

  • High-throughput screening approaches to identify compounds that can restore ER-mitochondria interactions disrupted by REEP1 mutations.

  • Investigation of gene therapy approaches, particularly for haploinsufficiency-related cases where restoring REEP1 expression might be therapeutic.

  • Deeper characterization of the REEP1-generated vesicular compartment and its functional significance in neurons.

  • Exploration of potential interactions between REEP1 and other HSP-related proteins to identify common pathways that could be targeted therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.