Recombinant Human Receptor expression-enhancing protein 3 (REEP3)

Shipped with Ice Packs
In Stock

Description

General Information

Receptor expression-enhancing protein 3 (REEP3) is a protein that, in humans, is encoded by the REEP3 gene . REEP3 is also associated with autism susceptibility . Additionally, REEP3 and REEP4 determine the tubular morphology of the endoplasmic reticulum . Reverse transcriptase (RT-PCR) has demonstrated that BC068557 and BC018658 mRNAs correspond to the same REEP3 gene .

Function and Characterization

REEPs are membrane-shaping adapter proteins that modulate specific G protein-coupled receptor trafficking by affecting ER cargo capacity . REEP3 and REEP4 function redundantly to remove the endoplasmic reticulum (ER) from mitotic chromosomes .

Role in Mitotic ER Shaping

REEP3/4 mediate high curvature of the ER specifically during mitosis . REEP4 protein levels were increased by approximately 50% in a mitotically enriched cell population, whereas REEP3 protein levels remained nearly unchanged . REEP3/4 contain residues in their C-terminal regions that promote mitosis-specific ER shaping and may be targets of regulatory inputs .

After REEP3/4 RNAi, large sheets appeared, which were fenestrated to a similar degree as the remaining sheet-like regions in control cells . ER profiles were distributed throughout the entire cell and extended into the spindle area .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its inclusion in the production process.
Synonyms
REEP3; C10orf74; Receptor expression-enhancing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
REEP3
Target Protein Sequence
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF
Uniprot No.

Target Background

Function
REEP3 is a microtubule-binding protein crucial for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum (ER) from chromosomes during mitosis, likely by clearing the ER membrane from metaphase chromosomes.
Gene References Into Functions
  1. REEP3 and REEP4 redundantly clear the ER from metaphase chromatin, ensuring proper mitotic progression and nuclear envelope architecture. PMID: 23911198
  2. Clinical trial data on gene-disease associations and gene-environment interactions (HuGE Navigator). PMID: 20379614
  3. REEP3, a human homolog of yeast Yop1p, may regulate ER-Golgi vesicle trafficking. It's also a positional candidate gene for autism. PMID: 17290275
  4. Observational study of gene-disease associations (HuGE Navigator). PMID: 16385451
  5. Observational study, meta-analysis, and genome-wide association study of gene-disease associations (HuGE Navigator). PMID: 18940312
Database Links

HGNC: 23711

OMIM: 609348

KEGG: hsa:221035

STRING: 9606.ENSP00000362863

UniGene: Hs.499833

Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in circumvallate papillae.

Q&A

Here’s a structured FAQ collection for researchers studying Recombinant Human REEP3, incorporating experimental design considerations, methodological insights, and data-driven analysis:

Advanced Research Questions

How to resolve contradictions in REEP3’s role in ER morphology during mitosis?

  • Conflict: Early studies reported ER as tubular , while others suggested cisternal .

  • Methodology:

    • Use RNAi depletion (REEP3/4 siRNA) and rescue assays with REEP4 mutants (e.g., REEP4N truncation) to test tubulation .

    • Combine confocal microscopy with EM to distinguish ER curvature .

    • Validate with cell-cycle-synchronized populations (e.g., thymidine block) .

How does REEP3 influence immune infiltration in pancreatic cancer?

  • Correlation: REEP3 upregulation correlates with CD8+ T cells (r = 0.484, p = 2.1×10⁻¹¹) and dendritic cells (r = 0.409, p = 2.84×10⁻⁸) .

  • Functional assay: Knockdown REEP3 in Panc-1 cells and profile cytokines via Luminex to identify immune recruitment pathways .

What strategies optimize recombinant REEP3 expression in HEK-293 systems?

  • Temperature modulation: Shift cultures to 33°C post-transfection to arrest cells in G₀/G₁, boosting yield by 1.5× .

  • Transfection comparison:

    ReagentDNA (µg)Efficiency
    Lipofectamine 20000.5High
    Calcium phosphate5.0Comparable

Data Contradiction Analysis

Why do REEP3 knockout studies show divergent phenotypes in ER-chromatin clearance?

  • Key variables:

    • Cell type specificity (e.g., U2OS vs. HeLa) .

    • Redundancy with REEP4: Dual knockdown is required for phenotype penetrance .

  • Validation: Perform co-immunoprecipitation (Co-IP) with REEP3/4 and quantify ER-chromatin overlap via 3D confocal reconstruction .

Methodological Best Practices

  • Antibody validation: Include lysates from REEP3-knockout cells as negative controls in WB/IF .

  • ER morphology assays: Use REEP4(mutRHD) mutants to decouple tubulation from chromatin clearance .

  • Immune correlation studies: Apply ssGSEA to TCGA-PAAD data, stratifying by REEP3 expression quartiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.