Recombinant Human Receptor expression-enhancing protein 4 (REEP4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
REEP4; C8orf20; PP432; Receptor expression-enhancing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
REEP4
Target Protein Sequence
MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHR RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDVDS
Uniprot No.

Target Background

Function
REEP4 is a microtubule-binding protein essential for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum from chromosomes during mitosis, likely by clearing the endoplasmic reticulum membrane from metaphase chromosomes.
Gene References Into Functions
  1. REEP3 and REEP4 exhibit functional redundancy in clearing the endoplasmic reticulum from metaphase chromatin, ensuring proper mitotic progression and nuclear envelope architecture. PMID: 23911198
Database Links

HGNC: 26176

OMIM: 609349

KEGG: hsa:80346

STRING: 9606.ENSP00000303482

UniGene: Hs.289063

Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in circumvallate papillae and testis.

Q&A

What is Recombinant Human Receptor Expression-Enhancing Protein 4 (REEP4) and what are its primary cellular functions?

REEP4 is a member of the Receptor Expression-Enhancing Protein (REEP) family, which primarily functions in enhancing the expression of G protein-coupled receptors (GPCRs) and maintaining endoplasmic reticulum (ER) membrane architecture. Bioinformatics analyses have revealed that REEP4 is predominantly localized in the cytosol and nucleoplasm, suggesting its multifaceted roles within cellular compartments . The protein is strongly implicated in vital cellular processes, particularly cell division and protein synthesis, indicating its fundamental importance in cellular homeostasis. Research has demonstrated that REEP4 is required for maintaining high ER membrane curvature during mitosis, which is essential for proper cell division. Additionally, REEP4 appears to be involved in protein binding functions, further highlighting its significance in cellular molecular interactions and signaling pathways .

How does REEP4 expression vary across different tissue types in normal physiological conditions?

Under normal physiological conditions, REEP4 exhibits differential expression patterns across various tissue types, providing insights into its tissue-specific functions. Pan-cancer analysis from TCGA datasets reveals that REEP4 expression in healthy tissues follows a distinct pattern, with baseline expression levels serving as important reference points for detecting dysregulation in pathological states . When comparing REEP4 expression between normal kidney tissues and other organ systems, researchers can identify tissue-specific regulatory mechanisms governing REEP4 expression. These variations in expression levels across different tissues suggest that REEP4 may perform specialized functions depending on the cellular context and tissue environment. The establishment of normal expression profiles is crucial for understanding how alterations in REEP4 levels contribute to disease pathogenesis, particularly in cancer development and progression .

What is known about the genomic structure and regulatory elements of the REEP4 gene?

The REEP4 gene structure and its regulatory elements play crucial roles in determining expression patterns across different tissues and in various pathological conditions. The gene contains specific promoter regions and transcription factor binding sites that control its expression in response to various cellular signals and environmental cues. Epigenetic modifications, including DNA methylation and histone modifications, contribute significantly to REEP4 regulation, potentially explaining tissue-specific expression patterns. Alternative splicing events have been documented for REEP4, resulting in different protein isoforms with potentially distinct functions or subcellular localizations. Understanding these genomic and regulatory aspects is essential for comprehending how REEP4 expression becomes dysregulated in cancer and other diseases, providing potential targets for therapeutic interventions aimed at normalizing REEP4 expression levels .

How is REEP4 expression altered in various cancer types, particularly in Kidney Clear Cell Carcinoma (KIRC)?

Comprehensive pan-cancer analysis has revealed significant alterations in REEP4 expression across multiple cancer types, with particularly notable upregulation in kidney clear cell carcinoma (KIRC). Data from TCGA and GEO datasets demonstrate significantly elevated REEP4 expression in breast invasive carcinoma (BRCA), cholangiocarcinoma (CHOL), liver hepatocellular carcinoma (LIHC), and KIRC compared to corresponding normal tissues (P<0.001) . In KIRC specifically, analysis of GEO data (GSE213324) comprising 40 samples revealed a substantial increase in REEP4 expression in tumor tissues compared to paired normal kidney tissues, a finding subsequently validated through Western blot and RT-PCR techniques . This upregulation of REEP4 in KIRC exhibits a positive correlation with tumor malignancy, suggesting that REEP4 overexpression may contribute to the aggressive phenotype of these tumors. Experimental validation in renal cancer cell lines (A498 and Caki-1) confirmed significantly higher REEP4 expression compared to normal kidney cells (HK-2), providing robust evidence for REEP4 dysregulation in KIRC at both tissue and cellular levels .

What cellular pathways and biological processes are associated with REEP4 in cancer development and progression?

Gene function analysis has revealed that REEP4 is implicated in several critical cellular pathways and biological processes that may contribute to cancer development and progression. GSEA (Gene Set Enrichment Analysis) identified significant associations between REEP4 and cell cycle regulation, a pathway frequently dysregulated in cancer, suggesting that REEP4 may influence tumor cell proliferation . Protein binding functions of REEP4 indicate its involvement in protein-protein interactions that potentially affect oncogenic signaling cascades within tumor cells. REEP4's role in maintaining ER membrane curvature during mitosis suggests that its upregulation might facilitate the rapid cell division characteristic of cancer cells, potentially contributing to tumor growth . Additionally, correlation analyses between REEP4 and genes involved in these pathways provide further evidence for its functional role in cancer biology. These findings collectively suggest that REEP4 may contribute to tumorigenesis through multiple mechanisms, including effects on cell proliferation, protein interaction networks, and cellular architecture maintenance .

What are the recommended methods for detecting and quantifying REEP4 expression in tissue samples and cell lines?

For accurate detection and quantification of REEP4 expression in experimental settings, researchers should employ a multi-modal approach combining protein and mRNA analysis techniques. Western blot analysis using rabbit polyclonal anti-REEP4 antibodies (such as those from Proteintech, USA, at 1:1,000 dilution) represents a reliable method for protein-level detection, with anti-β-Tubulin (1:5,000) serving as an appropriate loading control . Secondary antibody application using goat anti-rabbit IgG (H + L) with HRP conjugate (1:10,000) for 2 hours at room temperature provides optimal signal development. For visualization, chemiluminescence imaging systems (such as Tanon-5200) coupled with grayscale analysis using Image-J software enable quantitative assessment of REEP4 protein levels . At the mRNA level, RT-PCR offers complementary data on REEP4 expression, particularly valuable for confirming transcriptional upregulation in tumor tissues compared to normal controls. For high-throughput analysis, bioinformatics tools utilizing TCGA and GEO datasets provide valuable population-level expression data, with platforms such as TIMER (https://cistrome.shinyapps.io/timer/) and GEO2R (https://www.ncbi.nlm.nih.gov/geo/geo2r/) facilitating comprehensive expression pattern analysis across multiple cancer types and normal tissues .

How can researchers effectively manipulate REEP4 expression in experimental models to study its functions?

Establishing effective experimental models with manipulated REEP4 expression requires strategic approaches to gene modulation across various cellular contexts. For REEP4 overexpression studies, researchers should construct expression vectors containing the complete REEP4 coding sequence under strong promoters (such as CMV), followed by transfection into target cells using lipid-based reagents for transient expression or viral vectors for stable integration. Conversely, REEP4 knockdown can be achieved through RNA interference techniques, employing either siRNA for temporary suppression or shRNA for long-term silencing, with careful design of target sequences to ensure specificity and efficacy . The CRISPR-Cas9 system offers precision genome editing capability for generating REEP4 knockout models, particularly valuable for studying complete loss-of-function effects. For all genetic manipulation approaches, comprehensive validation through Western blot and RT-PCR is essential to confirm successful alteration of REEP4 expression levels . In selecting appropriate experimental models, researchers should consider both established renal cancer cell lines (A498, Caki-1) and normal kidney cells (HK-2) to recapitulate the differential expression observed in patient samples. Additionally, developing patient-derived xenograft models with varying REEP4 expression levels would provide physiologically relevant systems for investigating REEP4's role in tumor growth, metastasis, and response to therapeutic interventions .

What are the key considerations for designing functional assays to investigate REEP4's role in cancer-related cellular processes?

Designing robust functional assays to elucidate REEP4's role in cancer requires careful consideration of its implicated cellular processes and potential mechanisms of action. Cell proliferation assays, including MTT, CCK-8, or real-time cell analysis, should be prioritized given REEP4's association with cell cycle regulation, with assessment timepoints spanning 24-96 hours post-manipulation to capture both immediate and delayed effects . Migration and invasion assays using Transwell chambers (with or without Matrigel coating) would reveal REEP4's influence on metastatic potential, particularly relevant given its elevated expression in advanced-stage KIRC with distant metastases . Flow cytometry-based cell cycle analysis and apoptosis assays using Annexin V/PI staining would provide insights into how REEP4 affects cell division and survival, directly connecting to its known functions in mitosis. For mechanistic investigations, co-immunoprecipitation coupled with mass spectrometry would identify REEP4's protein interaction partners, illuminating its role in signaling networks . Additionally, immunofluorescence microscopy examining subcellular localization patterns of REEP4 during different cell cycle phases would complement functional data with spatial information. For in vivo relevance, researchers should consider xenograft models with modulated REEP4 expression to assess effects on tumor growth, angiogenesis, and metastasis formation, with immunohistochemical analysis of excised tumors to correlate REEP4 expression with proliferation markers (Ki-67), apoptosis (cleaved caspase-3), and vascular density (CD31) .

How does REEP4 influence the tumor microenvironment and immune cell infiltration in KIRC?

REEP4 expression demonstrates significant associations with the immune landscape in KIRC, suggesting its potential role in modulating tumor-immune interactions. ESTIMATE tool analysis revealed correlations between REEP4 expression levels and key tumor microenvironment parameters including "StromalScore," "ImmuneScore," and "ESTIMATEScore," providing insights into how REEP4 may influence the cellular composition of KIRC tumors . TIMER analysis demonstrated specific relationships between REEP4 expression and infiltration of various immune cell populations, including CD8+ T cells, B cells, dendritic cells, CD4+ T cells, macrophages, and neutrophils, with distinct patterns emerging that suggest REEP4's impact on immune surveillance mechanisms . Gene Set Variation Analysis (GSVA) further elucidated REEP4's influence on immune signaling pathways, potentially explaining the observed alterations in immune cell recruitment and function. These findings collectively indicate that REEP4 may contribute to the immunosuppressive microenvironment commonly observed in advanced KIRC, potentially through modulation of chemokine signaling, cytokine production, or expression of immune checkpoint molecules . Understanding these interactions has significant implications for immunotherapeutic approaches, particularly as REEP4 expression appears to correlate with responsiveness to immune checkpoint inhibitors in KIRC patients .

What is the relationship between REEP4 expression and response to immunotherapy in cancer patients?

Analysis of immunotherapeutic response parameters reveals significant associations between REEP4 expression levels and the efficacy of immune checkpoint inhibitors in KIRC patients. Patients with low REEP4 expression demonstrated enhanced sensitivity to PD-1 inhibitors alone (p=0.0130) and to combination therapy with CTLA4 and PD-1 inhibitors (p=0.0007), while CTLA4 inhibitors as monotherapy showed no significant effectiveness based on REEP4 expression status . Tumor Immune Dysfunction and Exclusion (TIDE) analysis revealed significantly lower TIDE scores in the low REEP4 expression group compared to the high expression group (p<0.0001), indicating reduced immune evasion potential . Further analysis demonstrated less pronounced T cell dysfunction in patients with low REEP4 expression (p<0.0001), though no significant difference in T-cell exclusion scores was observed between expression groups . These findings suggest that REEP4 expression status may serve as a valuable predictive biomarker for immunotherapy response in KIRC patients, potentially guiding treatment selection and sequencing. The molecular mechanisms underlying this relationship likely involve REEP4-mediated alterations in tumor cell immunogenicity, antigen presentation, or immune checkpoint molecule expression, presenting opportunities for combination therapeutic strategies targeting both REEP4 and immune pathways .

How can understanding REEP4's structure-function relationship inform the development of targeted therapeutics?

Elucidating the structure-function relationship of REEP4 presents valuable opportunities for developing targeted therapeutic approaches against REEP4-overexpressing cancers. Detailed structural analysis of REEP4's protein domains would identify critical regions mediating its interactions with binding partners, potentially revealing druggable pockets for small molecule inhibitors . Molecular modeling and simulation studies comparing normal and cancer-associated REEP4 variants could highlight conformational changes affecting protein function, guiding the design of conformation-specific inhibitors. Structure-guided mutagenesis experiments targeting key functional residues would validate essential domains required for REEP4's oncogenic activities, particularly those involved in cell cycle regulation and protein binding . For therapeutic development, high-throughput screening campaigns using structure-based virtual screening followed by biochemical validation could identify lead compounds disrupting REEP4's protein-protein interactions or enzymatic activities. Alternatively, exploring nucleic acid-based therapeutic approaches such as antisense oligonucleotides or siRNA delivery systems could effectively downregulate REEP4 expression in cancer cells . Understanding REEP4's structural determinants of subcellular localization would facilitate the development of targeted protein degradation approaches, such as PROTACs (Proteolysis Targeting Chimeras), specifically directing REEP4 for proteasomal degradation. These structure-informed therapeutic strategies could ultimately lead to precision medicine approaches for patients with REEP4-overexpressing tumors, particularly in KIRC where high REEP4 expression correlates with poor prognosis .

How does REEP4 expression correlate with sensitivity to specific anticancer drugs?

Analysis of drug sensitivity profiles in relation to REEP4 expression reveals significant associations with response to specific anticancer agents, potentially informing personalized treatment approaches. Data from the CellMiner database demonstrate that REEP4 expression positively correlates with sensitivity to quizartinib and SNS-314 drugs, suggesting enhanced efficacy of these agents in tumors with high REEP4 expression . Quizartinib, a selective FLT3 inhibitor, shows particularly promising activity in REEP4-overexpressing contexts, potentially indicating a previously unexplored mechanistic connection between REEP4 and FLT3 signaling pathways. Similarly, SNS-314, an Aurora kinase inhibitor targeting mitotic processes, demonstrates increased effectiveness in high REEP4 expression settings, aligning with REEP4's known involvement in cell division and mitosis . Conversely, certain drugs including dasatinib and pluripotin exhibit negative correlations with REEP4 expression, suggesting reduced efficacy in REEP4-overexpressing tumors and highlighting the importance of REEP4 expression status in treatment selection. These differential sensitivity patterns provide valuable insights for developing biomarker-guided treatment strategies, potentially allowing clinicians to prioritize therapies most likely to benefit patients based on tumor REEP4 expression profiles . Further investigation of these drug-REEP4 interactions could reveal novel combination approaches targeting both REEP4-dependent and independent pathways to overcome treatment resistance in cancer patients .

What molecular mechanisms might explain the relationship between REEP4 expression and drug response profiles?

The observed correlations between REEP4 expression and drug sensitivity profiles likely stem from complex molecular interactions involving REEP4's functions in cellular homeostasis and signaling networks. REEP4's involvement in cell cycle regulation may directly impact the efficacy of cell cycle-targeting drugs, particularly Aurora kinase inhibitors like SNS-314, potentially through modulation of mitotic checkpoint mechanisms or centrosome function . For quizartinib, a FLT3 inhibitor, the positive correlation with REEP4 expression suggests potential crosstalk between REEP4 and receptor tyrosine kinase signaling pathways, possibly through REEP4's protein binding functions or effects on receptor trafficking and localization . The negative correlation observed with dasatinib, a multi-kinase inhibitor targeting Src family kinases, suggests that REEP4 might confer resistance through compensatory signaling pathways or alterations in drug target accessibility. REEP4's localization in the cytosol and nucleoplasm positions it strategically to influence multiple cellular processes, potentially affecting drug permeability, intracellular accumulation, or efflux through modulation of membrane properties or transporter expression . Additionally, REEP4's role in protein synthesis may impact cellular stress response mechanisms activated upon drug exposure, affecting apoptotic thresholds and contributing to drug sensitivity patterns. These mechanistic insights provide a foundation for rational combination strategies targeting both REEP4-dependent pathways and complementary vulnerabilities to enhance therapeutic efficacy in REEP4-overexpressing tumors .

How can REEP4 expression data be integrated into predictive models for personalized cancer treatment?

Developing robust predictive models incorporating REEP4 expression data requires systematic integration of multiple data types and sophisticated computational approaches. Researchers should establish comprehensive datasets combining REEP4 expression profiles with drug sensitivity data across diverse cancer cell lines and patient-derived samples, utilizing repositories such as CellMiner, GDSC (Genomics of Drug Sensitivity in Cancer), and CTRP (Cancer Therapeutics Response Portal) . Machine learning algorithms, including random forests, support vector machines, or deep learning networks, can be trained on these datasets to identify complex patterns predicting drug response based on REEP4 expression levels in combination with other molecular features. Cross-validation techniques and independent validation cohorts are essential for assessing model robustness and generalizability, with performance metrics including area under the ROC curve (AUC), sensitivity, specificity, and positive/negative predictive values . Integration of additional molecular data layers—including transcriptomic, proteomic, and pathway activation signatures—can enhance model accuracy by capturing the broader biological context in which REEP4 operates. For clinical implementation, researchers should develop user-friendly tools or nomograms allowing clinicians to input patient-specific REEP4 expression levels and receive treatment recommendations with associated confidence intervals . Prospective clinical validation studies would ultimately be required to demonstrate the utility of these REEP4-based predictive models in improving patient outcomes through more precise treatment selection, potentially within the framework of biomarker-stratified clinical trials evaluating REEP4-informed therapeutic approaches .

What are the key unanswered questions about REEP4's role in normal physiology and disease pathogenesis?

Despite emerging evidence linking REEP4 to cancer progression, numerous fundamental questions remain regarding its physiological functions and pathological roles. The precise molecular mechanisms through which REEP4 influences cell cycle progression and protein synthesis require detailed elucidation, particularly regarding its interaction partners and regulatory phosphorylation sites under normal and pathological conditions . While REEP4's requirement for ER membrane curvature during mitosis has been established, the broader implications for cellular architecture maintenance across different tissue types remain largely unexplored. The tissue-specific expression patterns of REEP4 suggest potential specialized functions that warrant investigation, particularly in organs where REEP4 dysregulation correlates with disease development . The evolutionary conservation of REEP4 across species raises questions about its fundamental biological importance and potential redundancy with other REEP family members, necessitating comparative studies across model organisms. Additionally, the apparent contradictions between REEP4's roles in normal cellular function and cancer progression require mechanistic reconciliation—specifically addressing how a protein essential for normal mitosis becomes co-opted to promote oncogenesis . Understanding the upstream regulators controlling REEP4 expression in both physiological and pathological contexts represents another crucial knowledge gap, potentially revealing opportunities for indirect therapeutic targeting. These fundamental questions provide fertile ground for future research endeavors, potentially yielding insights applicable not only to cancer but also to other conditions where REEP4 dysregulation may contribute to disease pathogenesis .

What novel techniques and approaches could advance our understanding of REEP4 biology?

Advancing REEP4 research requires implementation of cutting-edge technologies that provide higher resolution insights into its molecular functions and interactions. Single-cell transcriptomics and proteomics approaches would reveal cell-specific REEP4 expression patterns within heterogeneous tumor tissues, potentially identifying particularly vulnerable cell populations for targeted interventions . Advanced imaging techniques, including super-resolution microscopy and live-cell imaging with fluorescently tagged REEP4, would provide unprecedented views of REEP4's dynamic localization and interactions during different cellular processes, particularly throughout the cell cycle. Cryo-electron microscopy could potentially resolve the three-dimensional structure of REEP4 and its complexes, providing atomic-level insights into its functional domains and interaction interfaces . CRISPR-based genetic screens (CRISPRi/CRISPRa) targeting REEP4 modulators would identify regulatory networks controlling its expression and function, potentially revealing indirect therapeutic targets. Proximity-dependent biotin labeling approaches (BioID, APEX) would map REEP4's protein interaction landscape in living cells under various conditions, providing context-specific insights into its functional networks . Patient-derived organoid models recapitulating REEP4 expression patterns observed in tumors would offer physiologically relevant systems for functional studies and drug screening. Implementation of these advanced technologies, particularly in combination, would significantly accelerate our understanding of REEP4 biology and its implications for cancer treatment, potentially revealing novel therapeutic vulnerabilities in REEP4-overexpressing tumors .

How might REEP4-targeted therapeutic approaches be developed and clinically implemented?

Developing clinically viable REEP4-targeted therapeutic approaches requires a systematic progression from preclinical proof-of-concept to clinical implementation strategies. Initial efforts should focus on validating REEP4 as a druggable target through comprehensive target validation studies, including genetic manipulation in patient-derived models and correlation of REEP4 dependency with molecular features across cancer types . Small molecule screening campaigns targeting REEP4 directly or its essential interaction partners could identify lead compounds for further development, with structural biology insights guiding medicinal chemistry optimization. Alternatively, exploring RNA-based therapeutics, including antisense oligonucleotides or siRNA delivered via nanoparticle formulations, could effectively downregulate REEP4 expression in tumor cells . For antibody-based approaches, developing antibody-drug conjugates targeting cell-surface proteins co-expressed with REEP4 could provide selective delivery of cytotoxic payloads to REEP4-overexpressing cells. Rational combination strategies pairing REEP4-targeted agents with immunotherapies or conventional chemotherapeutics should be explored, particularly given REEP4's associations with immunotherapy response and drug sensitivity profiles . Clinically, development of companion diagnostic assays quantifying REEP4 expression would enable patient selection for REEP4-targeted therapies, with standardized immunohistochemistry or RT-PCR protocols applicable to routine clinical specimens. Initial clinical trials would likely focus on KIRC patients with high REEP4 expression and poor prognostic features, potentially in the relapsed/refractory setting before expanding to front-line applications . Throughout development, biomarker analyses correlating treatment outcomes with REEP4 expression and associated molecular features would refine patient selection strategies, maximizing therapeutic benefit while minimizing unnecessary toxicities .

What are the broader implications of REEP4 research for understanding cancer biology and developing targeted therapies?

REEP4 research extends beyond its immediate role in KIRC, offering broader insights into fundamental cancer biology and therapeutic development principles. The consistent upregulation of REEP4 across multiple cancer types suggests it may represent a convergent adaptation supporting oncogenic transformation, providing a window into essential processes required for cancer cell survival and proliferation . REEP4's involvement in cellular architecture and cell division highlights the often-overlooked importance of structural proteins in cancer development, complementing the traditional focus on kinases and transcription factors. The correlation between REEP4 expression and immunotherapy response illustrates the increasingly recognized interplay between cancer cell-intrinsic features and immune microenvironment, potentially informing combination immunotherapy approaches across multiple tumor types . Methodologically, the successful integration of bioinformatic analyses with experimental validation in the REEP4 studies provides a template for efficient biomarker discovery in the era of large public datasets, potentially accelerating the identification of other clinically relevant molecules. The drug sensitivity correlations with REEP4 expression demonstrate the value of expression-based predictive biomarkers for existing therapeutics, potentially allowing rational repurposing of approved drugs for specific molecular contexts . Collectively, REEP4 research exemplifies how detailed investigation of individual proteins can yield insights that bridge basic science and clinical applications, ultimately contributing to the broader goal of precision oncology through improved patient stratification and treatment selection based on molecular features .

How can collaboration between different research disciplines accelerate progress in REEP4 research and its clinical applications?

Accelerating REEP4 research and its translation to clinical applications requires strategic interdisciplinary collaboration integrating diverse expertise and methodologies. Structural biologists and computational chemists working together can elucidate REEP4's three-dimensional structure and identify potential binding pockets, providing essential information for rational drug design approaches targeting REEP4 or its interactions . Cell biologists and cancer geneticists can combine their expertise to develop sophisticated cellular and animal models recapitulating REEP4 dysregulation in human tumors, creating platforms for mechanistic studies and preclinical testing of therapeutic candidates. Collaboration between immunologists and oncologists would enhance our understanding of how REEP4 influences tumor-immune interactions, potentially revealing novel immunotherapeutic approaches for REEP4-overexpressing cancers . Integrating pathologists and biostatisticians would facilitate the development and validation of standardized REEP4 assessment protocols for patient stratification, ensuring reliable translation of research findings to clinical decision-making. Industry partnerships between academic institutions and pharmaceutical companies could accelerate the development of REEP4-targeted therapeutics, combining academic insights with industrial drug development expertise and resources . Additionally, establishing international research consortia focused on REEP4 would enable pooling of resources, standardization of methodologies, and accumulation of larger patient cohorts for more robust analyses. These collaborative approaches, supported by data sharing platforms and regular interdisciplinary meetings, would significantly accelerate progress in understanding REEP4 biology and developing effective clinical applications, ultimately benefiting patients with REEP4-associated cancers .

Clinical Correlations of REEP4 Expression in KIRC Patients

This detailed analysis of clinical correlations demonstrates REEP4's significant prognostic implications in KIRC patients. The strong association between high REEP4 expression and decreased survival represents perhaps the most clinically relevant finding, establishing REEP4 as a potential prognostic biomarker . The moderate predictive accuracy indicated by ROC curve analysis suggests REEP4 expression alone has value but might be most effective when integrated with other clinical and molecular features in multi-parameter prognostic models. The positive correlations with advanced disease characteristics—including higher WHO grade, advanced T/N/M stages, and distant metastasis—further support REEP4's association with aggressive disease behavior . Crucially, multivariate Cox regression analysis establishing REEP4 as an independent prognostic factor (HR=1.036, p<0.001) confirms its value beyond established clinicopathological parameters, suggesting potential utility in refining risk stratification for KIRC patients .

Immunotherapy Response and Drug Sensitivity Correlations with REEP4 Expression

ParameterEffect of Low REEP4 ExpressionStatistical Significance
Response to PD-1 inhibitorsEnhanced sensitivityP=0.0130
Response to CTLA4 + PD-1 inhibitorsEnhanced sensitivityP=0.0007
Response to CTLA4 inhibitors aloneNo significant effectNot significant
TIDE ScoreDecreased (favorable)P<0.0001
T Cell DysfunctionDecreased (favorable)P<0.0001
T Cell ExclusionNo significant differenceNot significant
Quizartinib SensitivityNegative correlationSignificant
SNS-314 SensitivityNegative correlationSignificant
Dasatinib SensitivityPositive correlationSignificant
Pluripotin SensitivityPositive correlationSignificant

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.