Recombinant Human Relaxin receptor 1 (RXFP1)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms and Pathways

RXFP1 activation triggers multiple downstream pathways:

Primary pathways:

  • cAMP/PKA: Gαs-mediated adenylate cyclase activation (EC₅₀ = 0.2-1.6 nM)

  • PI3K-PKCζ: Gαi3-dependent pathway enhancing cAMP persistence

Secondary effects:

  • Matrix metalloproteinase upregulation (2-3 fold increase)

  • Collagen deposition reduction (40-60% in fibrotic models)

  • VEGF induction (1.5-2× baseline in endothelial cells)

Therapeutic Applications and Clinical Data

Table 2: Experimental Therapeutic Outcomes

ConditionModel SystemOutcome MetricResult
Acute Heart FailurePhase III Trial180-day mortality reduction37% decrease
Pulmonary FibrosisBleomycin mouseCollagen content reduction54±8%
Systemic SclerosisHuman skin biopsyRXFP1 expression restoration2.1-fold increase

Key findings from recent studies:

  • Recombinant RXFP1 shows 91% amino acid sequence conservation across mammalian species , though functional responses vary significantly (e.g., rabbit RXFP1 lacks relaxin response but maintains small-molecule agonism)

  • Small-molecule agonists (e.g., ML290) demonstrate equivalent efficacy to relaxin in cAMP activation (EC₅₀ = 5.8 μM vs relaxin's 0.3 nM)

Challenges in Therapeutic Development

Major limitations:

  • Tissue-specific RXFP1 downregulation in fibrosis (70% reduction in scleroderma patients)

  • Alternative splicing variants (6+ isoforms) with dominant-negative effects

  • Species-specific pharmacology:

    • Macaque: Full response to human relaxin (EC₅₀ = 0.8 nM)

    • Rabbit: Non-responsive to peptide agonists (pEC₅₀ >10,000 nM)

Table 3: Species Comparison of RXFP1 Activation

SpeciesRelaxin ResponseML290 ResponsecAMP Max (%)
Human+++ (0.3 nM)+++ (5.8 μM)100
Rhesus Macaque+++ (0.8 nM)+++ (6.2 μM)98±4
Guinea Pig++ (1.2 nM)+ (Partial)42±7

Emerging Research Directions

  1. Allosteric modulators:

    • Compound 1 (2-acetamido-N-phenylbenzamide derivative) shows 80% relaxin-mimetic activity at 10 μM

    • Chimera studies localize agonist binding to TM5-ECL3 regions

  2. Gene therapy approaches:

    • Adenoviral RXFP1 delivery reduces liver fibrosis markers by 60% in rodent models

  3. Dimerization effects:

    • RXFP1 homodimerization increases ligand affinity (Kd improvement from 0.4 nM to 0.1 nM)

    • Heterodimerization with RXFP2 alters signaling bias (cAMP vs ERK)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributor for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
RXFP1; LGR7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-757
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDEL DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ RMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYG SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV EMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
Uniprot No.

Target Background

Function
RXFP1 acts as a receptor for relaxins. Its activity is mediated by G proteins, stimulating adenylate cyclase and increasing cAMP levels. Ligand binding may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase responsible for cAMP degradation.
Gene References Into Functions
  1. Relaxin binding to RXFP1 recruits G proteins, subsequently activating adenylyl cyclase and elevating cAMP levels. PMID: 27310652
  2. The decreased expression of the endometrial RLX receptor in women experiencing implantation failures, including both in vitro fertilization failure and recurrent pregnancy loss, suggests a crucial role for RLX in the structural and functional changes of the endometrium during the window of implantation. PMID: 26761440
  3. Hormone receptor expression is concentrated in fibroblasts, with RXFP1 also evident in blood vessels and nerves. PMID: 28076930
  4. The complex binding mode of the peptide hormone H2 relaxin to its receptor RXFP1 has been deciphered. PMID: 27088579
  5. RXFP1 gene expression was dysregulated in the anterior cingulate of bipolar patients. PMID: 26238605
  6. H2 relaxin amide exhibits full activity at the relaxin receptor RXFP1, indicating that dimerization is not required for biological activity. PMID: 25547165
  7. A synthetic covalently linked dimeric form of H2 relaxin retains native RXFP1 activity and demonstrates improved in vitro serum stability. PMID: 25685807
  8. Using cells stably expressing RXFP1, we found that relaxin regulation of PPARgamma activity necessitates cAMP accumulation and subsequent activation of cAMP-dependent protein kinase (PKA). PMID: 25389293
  9. RXFP-1 receptors are present in the ligament, cartilage, and synovium of the temporomandibular joint, suggesting that it is a potential target for relaxin. This indicates that circulating relaxin might impact joint stability. PMID: 24797570
  10. To create a tool for investigating the low-affinity interaction, a protein scaffold system displaying exoloops 1 and 2 from RXFP1 was designed. PMID: 24640555
  11. RXFP1 is a complex G-protein coupled receptor (GPCR) with a rhodopsin-like 7 transmembrane helix region and a large ecto-domain containing Leucine-rich repeats and a Low Density Lipoprotein Class-A module at the N-terminus. PMID: 24640556
  12. Four microRNAs targeting human RXFP1 were developed and assessed. PMID: 24640558
  13. A quantitative high-throughput platform for an RXFP1 agonist screen was developed and evaluated. PMID: 23212924
  14. Increased expression of RXFP1 was reported in the placenta of patients with placenta accreta. PMID: 23302396
  15. The RXFP1 receptor lacking the LDLa module binds ligand normally but cannot signal through any known G protein-coupled receptor signaling pathway. PMID: 23926099
  16. These findings provide new insights into the binding and activation mechanisms of RXFP1 and RXFP2 by their native hormone ligands. PMID: 22973049
  17. Identification of key residues essential for the structural fold and receptor selectivity within the A-chain of human gene-2 (H2) relaxin. PMID: 23024363
  18. The decreased cellular expression of relaxin-2 receptor RXFP1 in scleroderma skin might represent a pro-fibrotic factor and contribute to the substantial inefficacy of relaxin treatment in systemic sclerosis, as reported in the literature. PMID: 23043266
  19. Relaxin-2 and its receptors RXFP1 and RXFP2 are expressed in the great saphenous vein (GSV) and their expression is significantly decreased in varicose GSV. PMID: 22737225
  20. [review] The relaxin receptor RXFP1 localizes in the acrosomal region of sperm. PMID: 22180889
  21. A decrease in the expression of the relaxin receptor in the placenta is associated with the occurrence and development of preeclampsia. PMID: 18843967
  22. LGR7 is constitutively expressed in human endometrium, and increased LGR7 immunostaining is demonstrated in the secretory phase, confirming the involvement of relaxin in the physiology of the endometrium and suggesting its role in implantation. PMID: 21324453
  23. Endometrial expression of relaxin and its receptor in endometriosis. PMID: 20655530
  24. A pre-assembled, constitutively active G-protein-coupled receptor signalosome has been uncovered, coupling the relaxin receptor, relaxin family peptide receptor 1 (RXFP1), to cAMP following receptor stimulation with sub-picomolar concentrations of peptide. PMID: 20664520
  25. These results suggest that relaxin activates PPARgamma activity and enhances the overall response in the presence of PPARgamma agonists, and this activation is dependent on the presence of RXFP1. PMID: 19712722
  26. RXFP1 is capable of mediating relaxin's action through an adenosine 3',5'-monophosphate (cAMP)-dependent pathway. PMID: 11809971
  27. Gene expression pattern and protein localization of the LGR7 receptor in human endometrium throughout the menstrual cycle. PMID: 14742692
  28. Binding to and gene expression of the LGR7 relaxin receptor undergo significant changes across the phases of the menstrual cycle, suggesting a specific role for the hormone in the physiology of the human uterus. PMID: 15240635
  29. Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142 over LGR7. PMID: 15465925
  30. Mouse and rat LGR7 share 85.2 and 85.7% identity with human LGR7. PMID: 15566402
  31. Data describe the conformation of the relaxin-binding site of the leucine-rich G-protein-coupled receptor 7. PMID: 15695505
  32. The relaxin receptor (LGR7) increases the transcription of IGFBP-1 and prolactin in decidual and endometrial stromal cells through the promoter region containing multiple CCAAT/enhancer-binding proteins (C/EBP) binding sites. PMID: 15722441
  33. Human LGR7 LDL-A module NMR studies demonstrate that calcium is required for the module to form a stable and correctly folded structure. PMID: 15956684
  34. The increase in LGR7 expression and H2 relaxin binding in the secretory phase of the menstrual cycle suggests a specific role for relaxin after ovulation in the human uterus. PMID: 15956698
  35. Amino acid sequence analysis of the LGR7 C-terminal tail and intracellular loops revealed multiple putative phosphorylation sites, suggesting that signal switching from Gs to Gi may occur after receptor phosphorylation. PMID: 15956719
  36. LGR7.10 splice variant is expressed at the cell surface, LGR7.2 is predominantly retained within cells, and LGR7.1 is partially secreted. None of these stimulate cAMP production. PMID: 16051677
  37. Relaxin stimulates leukocyte adhesion and migration through a relaxin receptor LGR7-dependent mechanism. PMID: 16303766
  38. The essential role of the LDLa module in LGR7 and LGR8 function is reported. PMID: 16963451
  39. Specific residues in the N-terminal region of the RXFP1 receptor low density lipoprotein receptor class A (LDLa) module play a key role in receptor activation. PMID: 17148455
  40. The LDL-A module of LGR7 influences receptor maturation, cell surface expression, and relaxin-activated signal transduction. PMID: 17158203
  41. The dominant-negative effects of the LGR7 splice variants expressed in the chorion and decidua could be functionally significant in the peripartal period. PMID: 18079195
  42. Analysis of truncated human relaxin-2 and -3 (H2 and H3) relaxin peptides and their binding and cAMP activities on RXFP1, RXFP2, and RXFP3. PMID: 18434306
  43. N-glycosylation at Asn-303 of RXFP1 was required for optimal intracellular cAMP signaling. PMID: 18533687
  44. RXFP1 is a constitutive dimer with negative cooperativity in ligand binding, and dimerization occurs through the 7TM domain. The ectodomain has a stabilizing effect on this interaction. PMID: 18723073
  45. The autocrine/paracrine actions of relaxin in the decidua are subject to additional controls at the level of expression of its receptor on the surface of its target cells. PMID: 19116340
  46. The apparent lack of classical regulation for RXFP1 and RXFP2 provides the molecular basis for the prolonged signaling and physiological actions of relaxin and related peptides. PMID: 19279230
  47. Point mutations of conserved residues or complete deletion of the LDL-A module resulted in a loss of the cAMP response to relaxin. PMID: 19416160
  48. Ligand-mediated activation of RXFP1 and RXFP2 is a complex process involving various domains of the receptors. PMID: 19416161
  49. Relaxin binds to RXFP2 with high affinity, while INSL3 has a very poor affinity for RXFP1. PMID: 19416162
  50. Data tested the hypothesis that relaxin plays a role in endometriosis by comparing the expression of relaxin mRNA and its LGR7 (RXFP1) receptor mRNA in normal human endometrium to those in samples from patients with endometriosis. PMID: 19416175

Show More

Hide All

Database Links

HGNC: 19718

OMIM: 606654

KEGG: hsa:59350

STRING: 9606.ENSP00000303248

UniGene: Hs.591686

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.

Q&A

What is RXFP1 and where is it expressed in human tissues?

RXFP1 is the main receptor for the peptide hormone relaxin and is expressed across multiple tissues in the human body. It is found in the heart, kidney, lung, skin, liver, blood vessels, and brain . This broad expression pattern explains the diverse physiological effects observed upon receptor activation. The receptor is a G protein-coupled receptor (GPCR) with unique structural characteristics, including a large ectodomain with 10 leucine-rich repeats (LRRs) . Expression studies using various techniques including RT-PCR and receptor autoradiography have provided detailed maps of RXFP1 distribution, though researchers should be cautious about interpretations from RT-PCR data alone as they may not always reflect physiologically relevant expression levels .

What is the primary signaling pathway activated by RXFP1?

RXFP1 primarily functions as a Gs protein-coupled receptor that stimulates adenylyl cyclase, resulting in increased intracellular cyclic adenosine monophosphate (cAMP) concentrations . This represents the most robust and well-characterized response to relaxin binding. For experimental assessment of RXFP1 activation, cAMP accumulation assays in various cell types are commonly employed, including OVCAR5 cells with endogenous RXFP1 expression or HEK293 cells with transiently expressed RXFP1 . When designing experiments to measure RXFP1 activity, researchers should note that basal cAMP levels can be heterogeneous across cell passages, necessitating appropriate normalization approaches (such as expressing results as a percentage of response to a standard concentration of relaxin) .

What physiological roles does RXFP1 play in normal human biology?

RXFP1 signaling regulates multiple physiological processes in both males and females. The receptor plays critical roles in:

  • Pregnancy and reproduction, where it contributes to myometrial quiescence and softening

  • The hypertrophy of the cervix during pregnancy

  • Development of mammary glands and papilla

  • Cardiovascular function including hemodynamic regulation

  • Tissue remodeling and anti-fibrotic processes

RXFP1 also modulates the physiology of numerous organs including the heart, lungs, liver, and other systems . When investigating RXFP1 biology, researchers should consider sex-specific differences in receptor expression and function, as these can significantly impact experimental outcomes.

How does RXFP1 engage multiple signaling pathways beyond cAMP?

While cAMP is the primary second messenger for RXFP1, the receptor activates multiple signaling pathways through complex coupling mechanisms. RXFP1 initially couples to Gs, but over time recruits coupling to G(alpha)(i3), causing additional cAMP accumulation via a G(alpha)(i3)-G beta gamma-phosphoinositide 3-kinase (PI3K)-protein kinase C (PKC) zeta pathway . Additionally, RXFP1 can activate Gi in vascular cells .

When studying RXFP1 signaling, researchers should account for:

  • Cell type-specific differences in signaling outcomes

  • Temporal dynamics of pathway activation

  • Potential biased signaling by different ligands

Beyond G-protein signaling, RXFP1 activation leads to stimulation of various MAP kinases including MEK, ERK1/2, Akt and p38, depending on the cell type . In vascular tissues, relaxin-2 produces endothelium- and nitric oxide (NO)-dependent relaxation of arteries through RXFP1 activation coupled to Gi2-PI3K pathways .

What is the mechanism of RXFP1 activation by relaxin binding?

Unlike typical glycoprotein hormone receptors that signal through a steric "push-pull" mechanism, RXFP1 activation involves a distinct process due to the small size (6 kDa) of the relaxin-2 peptide . Binding occurs through a two-step process:

  • High-affinity binding to the extracellular domain of RXFP1

  • Engagement with an additional binding site in the transmembrane (TM) exoloops

Structural analysis has revealed that once the B-chains of relaxin bind to the primary site in the leucine-rich repeats domain, the A-chain is presented in an orientation favorable for interaction with the TM exoloops . Critical residues involved in the activation mechanism include Leu402, Leu403, Phe564, and Leu566 in the hinge region and ECL2, which play essential roles in stabilizing the active conformation . Mutation studies have demonstrated that Leu402 and Leu403 are particularly crucial, as their substitution with alanine can completely abolish RXFP1 signaling .

How do cell and tissue-specific factors influence RXFP1 signaling outcomes?

RXFP1 signaling demonstrates remarkable tissue and cell-type specificity, which presents a significant challenge for translational research. In vascular cells, relaxin activates endothelial nitric oxide synthase (eNOS), while in other tissues it may stimulate neuronal NOS (nNOS) or induce expression of inducible NOS (iNOS) .

The downstream effects of RXFP1 activation are highly context-dependent:

Cell/Tissue TypePrimary Signaling PathwaysMajor Phenotypic Outcomes
Vascular cellsGi2-PI3K-Akt-eNOSVasodilation, NO production
Cardiac cellscAMP, PKA, ERK1/2Positive inotropic effects, cardioprotection
FibroblastscAMP, Notch-1, PI3K/AktAnti-fibrotic effects, reduced collagen production
Renal myofibroblastsG protein-dependent ERK1/2Matrix remodeling, anti-fibrotic effects

In rat isolated lungs, the relaxin-mediated iNOS upregulation depends on a delicate balance between stimulatory ERK1/2 activation and counter-regulatory PI3K stimulation . This complex interplay highlights why researchers must carefully select appropriate cell models that recapitulate the relevant signaling environment when studying RXFP1.

What are the most reliable assays for measuring RXFP1 activation?

Several methodological approaches can be employed to assess RXFP1 activation, each with specific advantages and limitations:

  • cAMP accumulation assays: The most commonly used readout for RXFP1 activation. OVCAR5 cells with endogenous RXFP1 expression or cell lines transiently expressing RXFP1 (HEK293-RXFP1, EA.hy926-RXFP1) are frequently utilized . For consistent potency (EC50) determinations across experiments, responses should be normalized to a positive control (typically 100 nM relaxin) due to heterogeneity in basal cAMP levels between cell passages .

  • Binding assays: Competition binding assays using labeled relaxin can determine binding affinity. HEK293 cells expressing human RXFP1 are commonly used for such studies .

  • Physiological readouts: In rodent models, chronotropic effects (increased heart rate) following RXFP1 activation provide a functional readout, though these effects are not translatable to humans . When using such models, researchers should be aware that higher doses of some RXFP1 agonists (like SA10SC-RLX) may be required compared to relaxin due to albumin binding affecting the free fraction available .

  • Cell-specific functional assays: For liver fibrosis research, expression of fibrotic markers in hepatic stellate cells (e.g., LX-2 cell line) provides disease-relevant readouts .

When selecting an assay system, researchers should consider that RXFP1 signaling is cell type-specific, and differences in activity between cAMP activation and phenotypic outcomes (like changes in fibrotic markers) may exist .

How can I establish appropriate RXFP1 expression systems for pharmacological studies?

Establishing reliable expression systems for RXFP1 requires careful consideration of several factors:

  • Expression level control: Physiological versus overexpression can significantly impact signaling outcomes. For comparative studies of mutants with lower expression, wild-type receptor expression might need to be reduced to enable fair comparisons .

  • Cell background selection: Different cell lines provide distinct signaling environments. Options include:

    • HEK293 cells for transient expression and basic signaling studies

    • OVCAR5 cells with endogenous RXFP1 expression

    • EA.hy926_RXFP1 cells for vascular biology studies

    • LX-2 human hepatic stellate cells for liver fibrosis research

  • Verification approaches:

    • Western blotting to confirm expression levels

    • Functional assays (cAMP accumulation) to verify receptor activity

    • Binding studies with labeled relaxin to confirm receptor presence at the cell surface

For mutation studies, researchers should verify that altered signaling is not simply due to reduced expression. When the L402A/L403A double mutant abolished RXFP1 signaling, expression was confirmed to be maintained at approximately 50% of wild-type levels, indicating a true functional deficit rather than an expression artifact .

What animal models are most appropriate for studying RXFP1 function in vivo?

While multiple animal models can be used to study RXFP1 biology, important species differences must be considered:

  • Rodent models: Common but with important limitations

    • Rats: Show chronotropic responses to RXFP1 activation not observed in humans

    • Mice: Used for pressure overload models of cardiac dysfunction where AAV9-mediated RXFP1 expression shows therapeutic potential

    • Species differences: Human relaxin-2 is the counterpart of mouse relaxin-1, and mouse RXFP1 shows 89% identity to human RXFP1

  • Transgenic approaches:

    • RXFP1 knockout models to assess receptor necessity

    • Tissue-specific RXFP1 expression (e.g., cardiac-specific expression using AAV9 vectors)

    • Reporter systems to track activation in specific tissues

When designing in vivo experiments, researchers should note that binding of relaxin to RXFP1 involves both common mechanisms across species and potential species-dependent differences in the interaction between relaxins, extracellular RXFP1 domains, and transmembrane exoloops . Additionally, pharmacokinetic considerations are important - SA10SC-RLX shows a longer half-life than relaxin due to albumin binding of its fatty acid chain, but this high albumin binding reduces its free fraction, requiring higher doses in vivo .

What is the evidence for RXFP1 as a therapeutic target in fibrotic diseases?

RXFP1 activation has demonstrated significant anti-fibrotic potential across multiple organ systems, supported by both preclinical and clinical evidence:

  • Liver fibrosis: Upregulation of RXFP1 expression has been observed in human fibrotic liver tissues, suggesting pathophysiological relevance. Studies in the human hepatic stellate cell line LX-2 have shown that RXFP1 activation can modulate expression of fibrotic markers .

  • Cardiac fibrosis: In models of pressure overload-induced cardiac dysfunction, AAV9-mediated RXFP1 expression showed therapeutic effects .

  • Clinical investigations: Hemodynamic effects of relaxin have been recapitulated in healthy volunteers and patients with chronic heart failure. A 2-day infusion of relaxin improved renal and cardiac function, reducing pulmonary congestion and mortality at 6 months in patients with acute heart failure .

How does RXFP1 signaling influence cardiovascular pathophysiology?

RXFP1 signaling exerts multiple beneficial effects on cardiovascular physiology and pathophysiology:

  • Hemodynamic effects: Relaxin produces vasodilation through endothelium- and NO-dependent relaxation of arteries via activation of RXFP1 coupled to Gi2-PI3K-Akt-eNOS pathways . This contributes to improved organ perfusion.

  • Heart failure: In models of decompensated heart failure, RXFP1 activation has demonstrated cardioprotective effects and positive inotropic actions. RXFP1 is predominantly expressed in atrial cardiomyocytes under normal conditions, but ectopic ventricular expression via AAV9 delivery showed therapeutic effects in pressure overload models .

  • Vascular remodeling: RXFP1 activation has been implicated in vascular remodeling processes, including effects on matrix metalloproteinases. Relaxin induces MMP-9 and MMP-13 via RXFP1, involving multiple pathways including PI3K, ERK, Akt and PKC-ζ .

  • Primary varicosis: A novel role for relaxin-2 has been identified in the pathogenesis of primary varicosis, suggesting RXFP1 signaling may influence venous pathology .

The cardioprotective mechanisms of RXFP1 activation appear to involve both direct effects on cardiomyocytes and indirect effects through vascular actions, highlighting the complexity of RXFP1 biology in cardiovascular disease.

What are the challenges in developing RXFP1-targeted therapeutics?

Development of RXFP1-targeted therapeutics faces several significant challenges:

  • Short half-life of peptide ligands: Human relaxin-2 (H2-RLX) has emerged as a potential therapy for cardiovascular and fibrotic diseases, but its short in vivo half-life presents an obstacle to long-term administration .

  • Low druggability: High-throughput screening efforts have failed to identify many specific agonists or positive allosteric modulators beyond ML290, suggesting RXFP1 has relatively low druggability for small molecule approaches .

  • Complex signaling biology: Differences in activity of compounds on cAMP activation compared with changes in expression of fibrotic markers indicate the need to better understand cell- and tissue-specific signaling mechanisms . This complexity makes target engagement and efficacy measurements challenging.

  • Delivery challenges: For gene therapy approaches using AAV9-RXFP1, ensuring appropriate tissue targeting and expression levels presents additional hurdles .

  • Translational gaps: Despite promising preclinical findings, there remain significant gaps in understanding how RXFP1 biology translates between animal models and humans. For example, chronotropic effects following RXFP1 activation observed in rodents are not translatable to humans .

Overcoming these challenges requires deeper understanding of tissue/cell-specific differences in RXFP1 expression, signaling pathways, and regulation of dependent genes in health and disease .

What are the key differences between peptide and small molecule RXFP1 agonists?

RXFP1 can be activated by both peptide ligands and small molecule agonists, each with distinct properties:

PropertyPeptide Agonists (e.g., Relaxin, SA10SC-RLX)Small Molecule Agonists (e.g., ML290)
Binding modeTwo-site binding: high-affinity binding to extracellular domain + engagement with transmembrane exoloops Different binding site than peptides, likely allosteric
Signaling profileActivates full spectrum of signaling pathwaysMay show biased signaling (activates many pathways similar to relaxin but does not cause ERK1/2 activation)
Duration of actionNative relaxin: short half-life; Modified peptides like SA10SC-RLX: extended duration Potentially longer duration depending on pharmacokinetic properties
AdministrationGenerally requires parenteral deliveryPotential for oral administration
Species selectivitySpecies differences in receptor recognition May show different species selectivity patterns

SA10SC-RLX represents an advancement in peptide design, showing a longer half-life and persistent activity compared to native relaxin. In rat models, SA10SC-RLX's effect on heart rate persisted for 15 hours versus only 4-6 hours for relaxin . This improved pharmacokinetic profile is attributed to binding of SA10SC-RLX's fatty acid chain to albumin, though this high albumin binding also reduces the free fraction available for receptor activation .

How can I characterize novel RXFP1 agonists or modulators?

Comprehensive characterization of novel RXFP1 ligands requires a multi-faceted approach:

  • Binding characterization:

    • Competition binding assays against labeled relaxin in HEK293 cells expressing human RXFP1

    • Saturation binding studies to determine affinity constants

    • Binding kinetics to assess association and dissociation rates

  • Functional assessment:

    • cAMP accumulation assays in multiple cell types (e.g., OVCAR5, EA.hy926_RXFP1)

    • Activation EC50 determination, normalized to relaxin response

    • Assessment in cell lines expressing various species orthologs (human, rat, mouse RXFP1)

  • Signaling pathway profiling:

    • Beyond cAMP, evaluate activation of other pathways (ERK1/2, Akt, p38, NO production)

    • Biased signaling assessment comparing pathway activation patterns to relaxin

    • Cell type-specific signaling outcomes in disease-relevant cell models

  • In vivo pharmacology:

    • Pharmacokinetic studies to determine half-life and distribution

    • In rats, chronotropic effects provide a functional readout

    • Efficacy in disease models (fibrosis, heart failure, etc.)

When comparing novel compounds to relaxin, researchers should consider using relaxin as a positive control within each experiment to account for inter-assay variability. For example, when characterizing SA10SC-RLX, data were expressed as a percentage of the 100 nM relaxin response for each experiment due to heterogeneous basal cAMP levels between cell passages .

What approaches can overcome the challenges in developing small molecule RXFP1 modulators?

Despite the low druggability of RXFP1, several strategic approaches may enhance the discovery of effective small molecule modulators:

  • Structure-based design: Leveraging structural insights from cryo-EM studies of the RXFP1-relaxin-Gs complex to identify potential binding pockets and design targeted compounds .

  • Focus on allosteric sites: The allosteric agonist ML290 demonstrates that alternative binding sites exist. Expanding efforts to identify and target novel allosteric pockets may yield compounds with distinct pharmacological profiles .

  • Biased ligand development: Designing compounds that selectively activate beneficial signaling pathways while avoiding unwanted effects. The observation that ML290 stimulates many relaxin-activated pathways without ERK1/2 activation suggests pathway selectivity is achievable .

  • Modified peptide approaches: SA10SC-RLX and other single-chain relaxin peptide mimetics (compounds 54, 59, and 64) demonstrate that structural modifications to peptide ligands can improve pharmacokinetic properties while maintaining receptor activity .

  • Cell-specific screening cascades: Developing optimized screening approaches using therapeutically relevant cells that express physiological densities of RXFP1, rather than overexpression systems .

  • Improved understanding of disease-relevant signaling: Better characterization of the specific RXFP1-mediated pathways that drive therapeutic benefits in different disease contexts will enable more focused screening strategies .

The discovery of novel ML290 analogues has provided valuable tools for understanding cell- and tissue-specific signaling mechanisms, even if these compounds have not yet advanced to clinical development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.