Recombinant Human Relaxin receptor 2 (RXFP2)

Shipped with Ice Packs
In Stock

Description

Reproductive Function

RXFP2 is indispensable for testicular descent during fetal development. Mutations in RXFP2 or INSL3 are linked to cryptorchidism (undescended testes), with downstream risks of infertility and testicular cancer .

Bone Metabolism

RXFP2 activation promotes osteoblast mineralization and bone formation. Preclinical studies show that RXFP2 agonists improve trabecular bone parameters in mice, suggesting therapeutic potential for osteoporosis .

Cardiovascular and Adrenal Pathology

Recent genome-wide association studies implicate RXFP2 in resistant hypertension (rHTN) in men. Adrenal RXFP2 overexpression correlates with elevated aldosterone and cortisol secretion, driving hypertension .

Ligand Binding and Activation Mechanisms

  • INSL3 Interaction: Binds RXFP2 via the LRR domain, inducing LDLa module reorientation to activate transmembrane signaling .

  • Relaxin Cross-Activation: Human H2 relaxin activates RXFP2 in vitro but lacks physiological relevance in vivo .

Small Molecule Agonists

High-throughput screening identified orally bioavailable RXFP2 agonists (e.g., compounds 6641, 4337) that:

  • Enhance osteoblast mineralization (3.5-fold increase in vitro) .

  • Rescue gubernacular defects in mouse embryos .

CompoundTargetEC₅₀ (nM)Application
6641Human/mouse RXFP210–50Osteoporosis, cryptorchidism
4337Human RXFP220–100Bone loss models
Pharmacological profiles of RXFP2 agonists .

Monoclonal Antibodies (mAbs)

Neutralizing RXFP2 mAbs reduce aldosterone and cortisol production in adrenal cells, offering a novel strategy for rHTN .

Clinical and Preclinical Implications

  • Hypertension: RXFP2 antagonists (mAbs, small molecules) show promise for resistant hypertension, particularly in male patients .

  • Bone Disorders: Agonists improve trabecular bone volume (15–20% increase in murine models) .

  • Reproductive Health: Recombinant INSL3/RXFP2 therapies are under investigation for cryptorchidism .

Future Directions

  • Dual-Target Therapies: Combining RXFP2 agonists with bisphosphonates for synergistic bone repair.

  • Gender-Specific Trials: Evaluating RXFP2 inhibitors in male-dominated hypertensive cohorts .

  • Structural Studies: Cryo-EM analyses to resolve ligand-receptor binding dynamics.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
RXFP2; GPR106; GREAT; LGR8; Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-754
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLP RAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKET ELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA FFGLCNLQILYLNHNCITTLRPGIFKDLHQLTWLILDDNPITRISQRLFTGLNSLFFLSM VNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLTVLFLPRNQIGFVPEKT FSSLKNLGELDLSSNTITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDL ERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRI FVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYRG QYQKYALLWMESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSV ILICIWMAGFLIAVIPFWNKDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLL AFLIIVFSYITMFCSIQKTALQTTEVRNCFGREVAVANRFFFIVFSDAICWIPVFVVKIL SLFRVEIPDTMTSWIVIFFLPVNSALNPILYTLTTNFFKDKLKQLLHKHQRKSIFKIKKK SLSTSIVWIEDSSSLKLGVLNKITLGDSIMKPVS
Uniprot No.

Target Background

Function
RXFP2 serves as the receptor for relaxin. Its activity is mediated by G proteins, leading to the stimulation of adenylate cyclase and an increase in cAMP levels. It may also function as a receptor for Leydig insulin-like peptide (INSL3).
Gene References Into Functions
  1. Sex-stratified analysis within the TMD discovery cohort identified two additional genome-wide significant loci in females. One, located upstream of the relaxin/insulin-like family peptide receptor 2 (RXFP2) (chromosome 13, rs60249166, [OR] = 0.65, P = 3.6 x 10(-8)), was replicated among females in the meta-analysis (1-tailed P = 0.052). The other (chromosome 17, rs1531554, OR = 0.68, P = 2.9 x 10(-8)) was replicated among females in the meta-analysis. PMID: 28081371
  2. This study mapped key regions within the RXFP2 low-density lipoprotein class-A module that are involved in signal activation. PMID: 24983702
  3. Findings suggest a novel and gender-specific role for INSL3 and its cognate receptor RXFP2 signaling in maintaining ocular surface homeostasis. PMID: 23539510
  4. Haplotype analysis of the RXFP2 gene in T222P carriers and their parents demonstrated that this variant is linked to the previously inferred C-C-G-A-13 haplotype, further supporting the 'founder effect' hypothesis. PMID: 20636340
  5. Elevated expression of LGR8 may facilitate tumor invasiveness in the early stages of hepatocellular carcinoma. PMID: 21789898
  6. Data indicate that a synthetic parallel dimer of the B-chain of INSL3 is a potent inhibitor of the native peptide's binding to its receptor, RXFP2. PMID: 20560146
  7. It appears that the only clinical consequence of alterations in the INSL3-LGR8 system is the failure of the testis to normally descend into the scrotum during embryonic development, without affecting the spermatogenic and endocrine functions of the testis itself. PMID: 12970298
  8. Mutations affecting the human LGR8 gene are not a common cause of cryptorchidism in the Finnish population. PMID: 14656401
  9. The recurrent T222P mutation in the LGR8 gene was not found in any of the patients studied. These data demonstrate, for the first time, a lack of association between genetic factors essential for correct testicular descent and anorchia. PMID: 15579790
  10. LGR8 signaling is activated by the relaxin-like factor. PMID: 15708846
  11. The LGR8.1 spliced isoform is expressed on the cell surface but is unable to stimulate cAMP production. PMID: 16051677
  12. Alanine-substituted analogs were used to identify the key residues of INSL3 that are responsible for its interaction with the ectodomain of LGR8. These include Arg(B16) and Val(B19), with His(B12) and Arg(B20) playing secondary roles. PMID: 16867980
  13. A novel allele of LGR8 (R223K) was found in one patient with retractile testes. PMID: 16926383
  14. The V18M mutation in the insulin-like factor 3 signal peptide had a significant deleterious effect on activating the LGR8 receptor in ex vivo studies. PMID: 17437853
  15. This study predicted the complete INSL3/LGR8 primary binding site, including interactions between INSL3 His-B12 and LGR8 Trp-177, INSL3 Val-B19 and LGR8 Ile-179, and INSL3 Arg-B20 with LGR8 Asp-181 and Glu-229. PMID: 17473281
  16. Negative cooperativity is present, and INSL3-RXFP2 binding exhibits both similarities and differences compared to insulin binding to the insulin receptor. PMID: 18063691
  17. The T222P mutation cannot be considered either causative or a susceptibility factor for cryptorchidism. PMID: 18073304
  18. No association was found between the T222P/LGR8 mutation and cryptorchidism in the Moroccan population. PMID: 18772597
  19. Relaxes binds with high affinity to the leucine-rich repeats of RXFP2 in a manner similar to INSL3 binding to its receptor. PMID: 19416162
  20. Several missense mutations were described in both the INSL3 and RXFP2 genes. A novel V39G INSL3 mutation was identified in a patient with cryptorchidism. PMID: 19416188
  21. This study confirmed the association between INSL3 and RXFP2 gene mutations and human cryptorchidism. PMID: 19416190
  22. Data link RXFP2 gene mutations to human osteoporosis. PMID: 19416191

Show More

Hide All

Database Links

HGNC: 17318

OMIM: 219050

KEGG: hsa:122042

STRING: 9606.ENSP00000298386

UniGene: Hs.680763

Involvement In Disease
Cryptorchidism (CRYPTO)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed mainly in the brain, kidney, muscle, testis, thyroid, uterus, peripheral blood cells and bone marrow.

Q&A

What is RXFP2 and what are its primary ligands?

RXFP2 is a G protein-coupled receptor that belongs to the relaxin family peptide receptor group. Its primary endogenous ligand is insulin-like peptide 3 (INSL3), though it can also be activated by human relaxin-2 (H2 relaxin) with high affinity. RXFP2 activation typically leads to an increase in intracellular cAMP levels through Gαs protein coupling. The receptor shares approximately 10% sequence identity with related receptors RXFP3 and RXFP4, which function through different signaling mechanisms (Gαi protein coupling) . RXFP2 contains leucine-rich repeats (LRRs) in its ectodomain that are critical for ligand binding and receptor activation .

How does RXFP2 differ from RXFP1 in structure and function?

While both RXFP1 and RXFP2 are members of the same receptor family and share structural similarities, they have distinct functions and ligand specificities:

The activation mechanisms differ notably between the two receptors. For instance, truncation of the N-terminal part of the A-chain in INSL3 results in a high-affinity antagonist for RXFP2, whereas similar truncations of H2 relaxin merely lead to lower-affinity agonists for RXFP1 .

What experimental models are suitable for studying RXFP2 function?

Several experimental models have proven effective for studying RXFP2 function:

  • Cell-based assays: HEK293T cells stably expressing human or mouse RXFP2 are commonly used for in vitro studies, particularly with reporter systems like CRE-luciferase assays or HTRF cAMP accumulation assays to measure receptor activation .

  • Embryonic models: Mouse embryo gubernacular invagination studies can be employed to assess RXFP2 agonist activity in developmental contexts .

  • Bone models: Human osteoblast mineralization assays in vitro and measurement of bone trabecular parameters in adult mice can be used to study RXFP2's role in bone metabolism .

  • Binding assays: Competitive binding assays using radiolabeled ligands help determine binding affinities and receptor selectivity profiles of potential RXFP2 modulators .

When designing experiments, it's crucial to consider species differences in receptor pharmacology, as subtle differences may exist between human and mouse RXFP2 responses, though the binding sites for small molecule agonists appear to be conserved between species .

What are the key structural determinants for selective RXFP2 activation?

The selective activation of RXFP2 involves multiple structural elements that distinguish it from related receptors. Research has identified several critical regions:

  • Binding cassette recognition: The relaxin binding cassette RXXXRXX(I/V) in the B-chain of ligands like H2 relaxin interacts with the leucine-rich repeats (LRRs) of the receptor ectodomain. Each arginine residue is coordinated by pairs of acidic residues that form hydrogen bond networks, while the isoleucine (I) or valine (V) interacts with a hydrophobic cluster on the LRR surface .

  • Secondary activation interactions: Unlike RXFP1, where the activation domain appears to be in the mid-to-C-terminal part of the A-chain, RXFP2 activation by INSL3 involves the N-terminal part of the A-chain. Truncation studies have shown that removing the N-terminal A-chain from INSL3 creates antagonists for RXFP2, highlighting this region's importance in receptor activation .

  • B-chain C-terminus: Research suggests that the C-terminal region of the B-chain may contribute to RXFP2 selectivity, as truncations in this region can alter receptor specificity profiles between RXFP1 and RXFP2 .

For researchers designing selective RXFP2 modulators, focusing on these structural elements can yield compounds with improved selectivity profiles compared to natural ligands like H2 relaxin, which activate both RXFP1 and RXFP2.

How can small molecule RXFP2 agonists be identified and optimized?

The identification and optimization of small molecule RXFP2 agonists involves a systematic approach:

  • High-throughput screening: Quantitative high-throughput screening using diverse compound libraries (such as the NCATS/NIH diversity collection) against cells expressing RXFP2 can identify initial hit compounds. Detection methods like homogenous time-resolved fluorescence (HTRF) assays measuring cAMP accumulation, with forskolin or recombinant INSL3 as positive controls, are effective for primary screening .

  • Dose-response characterization: Hit compounds should be tested at multiple concentrations to generate complete dose-response curves and determine EC50 values .

  • Selectivity profiling: Promising compounds must be evaluated against related receptors (RXFP1, RXFP3, RXFP4) to confirm selectivity. For example, using HEK293T cells stably transfected with human or mouse RXFP1 can determine whether compounds cross-react with this related receptor .

  • Efficacy assessment: CRE-luciferase reporter assays can distinguish between full and partial agonists by comparing maximal responses to reference compounds .

  • Species conservation testing: Compounds should be tested against both human and mouse receptors to ensure conservation of activity across species, which is essential for subsequent in vivo evaluation .

  • Structural optimization: Lead compounds can be chemically modified to improve potency, selectivity, oral bioavailability, and pharmacokinetic properties .

Successfully optimized RXFP2 agonists should demonstrate high potency (typically nanomolar EC50 values), selectivity over related receptors, good oral bioavailability, and favorable pharmacokinetic properties to enable in vivo evaluation .

What are the challenges in developing long-acting RXFP2 modulators?

Developing long-acting RXFP2 modulators presents several significant challenges:

  • Short half-life of peptide ligands: Natural ligands like relaxin-2 have very short serum half-lives, limiting their clinical applications. For example, recombinant relaxin-2 has a circulation half-life so brief that it requires continuous infusion in clinical settings .

  • Maintaining receptor activity while extending half-life: Protein engineering approaches, such as fusion to antibody Fc fragments, can significantly extend half-life (from minutes to days) but risk compromising receptor binding or activation. The challenge lies in preserving the critical binding epitopes while adding half-life extension domains .

  • Selectivity concerns with extended exposure: Long-acting modulators may increase the risk of off-target effects due to prolonged systemic exposure, particularly given the cross-reactivity potential between relaxin receptors .

  • Formulation and delivery challenges: Peptide-based modulators often face stability, solubility, and delivery challenges that must be addressed through formulation strategies or chemical modifications .

Researchers have made progress in addressing these challenges. For instance, optimized fusions between relaxin-2 and antibody Fc fragments have achieved circulating half-lives of approximately 3-5 days in mice while maintaining potent RXFP1 receptor agonist activity both in vitro and in vivo . Similar strategies could potentially be applied to develop long-acting RXFP2-selective modulators.

What are the optimal assay systems for evaluating RXFP2 activation?

Several complementary assay systems can be employed to comprehensively evaluate RXFP2 activation:

  • cAMP accumulation assays: Since RXFP2 primarily signals through Gαs-mediated cAMP production, homogenous time-resolved fluorescence (HTRF) assays directly measuring cAMP accumulation in RXFP2-expressing cells provide a robust primary readout of receptor activation. These assays can detect compound-induced cAMP increases, with forskolin or recombinant INSL3 serving as positive controls .

  • CRE-luciferase reporter assays: These assays utilize the cAMP response element (CRE) linked to a luciferase reporter gene to measure downstream signaling activation. They are particularly useful for determining whether compounds are full or partial agonists by comparing their maximal responses to reference agonists. For example, in mouse RXFP2 CRE-luciferase assays, compound 6641 was identified as a full agonist while compounds 4337 and 4340 were partial agonists .

  • Competitive binding assays: These assays use radiolabeled ligands (typically 125I-labeled INSL3 or relaxin) to measure displacement by test compounds, providing direct evidence of binding affinity. They help distinguish between compounds that directly bind the orthosteric site versus those that may act allosterically .

  • Functional cellular assays: Beyond immediate signaling, assays measuring physiologically relevant cellular responses provide important validation. For RXFP2, these include:

    • Human osteoblast mineralization assays measuring calcium deposition

    • Gubernacular cell migration or invagination assays relevant to reproductive development

When establishing these assays, careful attention to cell type, receptor expression levels, assay sensitivity, and appropriate positive and negative controls is essential for generating reliable and reproducible results.

How can truncated relaxin peptides be synthesized and characterized for RXFP2 research?

The synthesis and characterization of truncated relaxin peptides for RXFP2 research involves several specialized techniques:

  • Chemical synthesis approach:

    • Solid-phase peptide synthesis using N-(9-fluorenyl)methoxycarbonyl (Fmoc) chemistry can be employed to produce individual A- and B-chains with desired truncations .

    • The chains are then combined through sequential oxidative formation of disulfide bonds between conserved cysteine residues .

    • This approach offers flexibility in designing truncated variants but becomes increasingly challenging with larger peptides.

  • Critical characterization methods:

    • Reverse-phase HPLC for purity assessment

    • Mass spectrometry for molecular weight confirmation

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements (α-helices, β-sheets)

    • Nuclear magnetic resonance (NMR) to assess three-dimensional structural integrity

  • Functional characterization:

    • Competitive binding assays to determine receptor affinity (indicated as pKi values)

    • cAMP stimulation assays to assess potency (pEC50) and efficacy

    • Comparison with native H2 relaxin as a benchmark

Research has demonstrated that truncated peptides like H2-(A4–24)(B7–24) can maintain significant activity at RXFP1 while showing reduced or abolished activity at RXFP2, creating receptor-selective variants. These minimized peptides can be approximately one-third smaller than native H2 relaxin, making them more accessible for chemical synthesis and potentially more cost-effective for research and therapeutic applications .

What considerations are important when evaluating RXFP2 agonists in vivo?

When evaluating RXFP2 agonists in vivo, researchers should consider several important factors:

  • Pharmacokinetic properties:

    • Determine the half-life, clearance rate, and volume of distribution

    • Assess oral bioavailability if oral administration is intended

    • Consider the impact of protein binding on free drug concentration

    • Evaluate whether compounds cross the blood-brain barrier if central effects are relevant

  • Dosing regimen optimization:

    • Establish dose-response relationships to identify minimally and maximally effective doses

    • Determine appropriate dosing frequency based on pharmacokinetic parameters

    • Consider potential tolerance or receptor desensitization with repeated dosing

  • Appropriate model selection:

    • For reproductive studies: models examining gubernacular development in male embryos can assess RXFP2's role in testicular descent

    • For bone metabolism: adult mouse models measuring bone trabecular parameters can evaluate effects on bone density

    • Consider genetic backgrounds and any confounding comorbidities in animal models

  • Biomarkers and endpoints:

    • Define clear, quantifiable endpoints relevant to RXFP2 biology

    • For bone studies: measure bone mineral density, trabecular parameters, and osteoblast activity markers

    • For reproductive studies: assess testicular position, gubernacular development, and reproductive hormone levels

  • Controls and comparators:

    • Include appropriate vehicle controls

    • Where available, use reference RXFP2 agonists (such as recombinant INSL3) as positive controls

    • Consider including H2 relaxin as a comparator to assess relative efficacy and selectivity in vivo

Small molecule RXFP2 agonists with favorable pharmacokinetic properties (including oral bioavailability) offer significant advantages over peptide ligands for in vivo evaluation, potentially enabling more convenient dosing regimens while maintaining selective receptor activation .

What are the emerging therapeutic applications for RXFP2 modulators?

Several promising therapeutic applications for RXFP2 modulators are emerging from recent research:

  • Bone metabolism disorders:

    • Small molecule RXFP2 agonists have demonstrated the ability to increase mineralization activity in human osteoblasts in vitro and improve bone trabecular parameters in adult mice .

    • This suggests potential applications in osteoporosis and other conditions characterized by bone loss.

    • The restricted expression profile of RXFP2 combined with highly specific small molecule agonists may provide targeted therapy with minimal side effects .

  • Reproductive disorders:

    • Given RXFP2's role in gubernacular development and testicular descent, RXFP2 agonists may have applications in treating cryptorchidism (undescended testes) .

    • Conversely, RXFP2 antagonists might have applications in male contraception by temporarily modulating reproductive functions.

  • Targeted applications versus RXFP1 therapeutics:

    • While RXFP1 activation by relaxin-2 has shown promise in heart failure and fibrotic conditions, the development of RXFP2-selective modulators allows for targeted applications with potentially fewer off-target effects .

    • Minimized relaxin peptides that maintain RXFP1 activation while eliminating RXFP2 activation (such as H2-(A4–24)(B7–24)) may be valuable for treating conditions where RXFP1 activation is desired but RXFP2 activation would be counterproductive .

  • Diagnostic applications:

    • RXFP2 modulators labeled with imaging agents could potentially be used to visualize tissues with high RXFP2 expression, aiding in diagnosis or treatment monitoring.

The development of orally bioavailable small molecule RXFP2 agonists with favorable pharmacokinetic properties represents a significant advance over peptide-based approaches, potentially enabling more convenient dosing regimens for chronic conditions .

How can artificial intelligence and computational methods enhance RXFP2 drug discovery?

Artificial intelligence and computational methods can significantly accelerate and enhance RXFP2 drug discovery through several approaches:

  • Structure-based drug design:

    • Homology modeling of RXFP2 based on related GPCRs with known crystal structures

    • Molecular docking to predict binding modes of potential ligands

    • Molecular dynamics simulations to understand receptor-ligand interactions over time

    • These approaches can guide rational design of selective RXFP2 modulators with optimized binding properties

  • Machine learning for hit identification:

    • Development of predictive models based on existing RXFP2 modulators

    • Virtual screening of large compound libraries to identify novel chemotypes

    • Quantitative structure-activity relationship (QSAR) models to predict potency and selectivity

    • Active learning approaches to guide experimental testing and iteratively improve models

  • AI-driven optimization strategies:

    • Generative models (such as variational autoencoders or generative adversarial networks) to design novel compounds with desired properties

    • Multi-parameter optimization to balance potency, selectivity, pharmacokinetics, and safety profiles

    • Reinforcement learning to optimize synthetic routes for lead compounds

  • Integration with experimental data:

    • High-content screening data analysis to identify phenotypic signatures of RXFP2 modulation

    • Analysis of transcriptomic responses to RXFP2 activation to better understand downstream effects

    • Automated structure-activity relationship extraction from literature and patents

These computational approaches are particularly valuable for RXFP2 drug discovery given the challenges of working with this receptor class and can significantly reduce the time and resources required to identify promising therapeutic candidates.

What are the key considerations for developing bispecific modulators targeting RXFP2 and related receptors?

Developing bispecific modulators that intentionally target both RXFP2 and related receptors (such as RXFP1) presents unique opportunities and challenges:

  • Rationale for bispecific targeting:

    • Some therapeutic applications might benefit from simultaneous modulation of multiple relaxin family receptors

    • For conditions like heart failure with concurrent bone loss, a bispecific RXFP1/RXFP2 agonist could provide cardiovascular benefits via RXFP1 and bone-strengthening effects via RXFP2

    • Natural H2 relaxin already demonstrates this bispecific activity, activating both RXFP1 and RXFP2 with high affinity

  • Design strategies:

    • Peptide engineering: Starting with natural H2 relaxin and selectively modifying regions to tune relative affinities for RXFP1 and RXFP2

    • Fusion proteins: Creating chimeric proteins that incorporate binding elements for multiple receptors

    • Small molecule approaches: Developing compounds that interact with conserved binding pockets across receptor subtypes while maintaining desired signaling profiles

  • Critical design considerations:

    • Balanced activity: Achieving the desired ratio of activities at each receptor target

    • Signaling bias: Ensuring appropriate signaling pathway activation at each receptor

    • Pharmacokinetic alignment: Designing modulators where the pharmacokinetic profile appropriately matches the desired therapeutic effect duration at both receptors

    • Selectivity limits: Maintaining selectivity against undesired targets while intentionally targeting multiple related receptors

  • Development challenges:

    • More complex pharmacological characterization required

    • Potentially more complicated toxicology profile

    • Regulatory considerations for multi-target therapeutics

    • Intellectual property strategy for bispecific modulators

Understanding the subtle structural differences between RXFP2 and related receptors is crucial for successful bispecific modulator development. For example, research has shown that truncations of the B-chain C-terminus can substantially affect the relative affinity for RXFP1 versus RXFP2, providing a potential starting point for engineering bispecific modulators with tunable receptor selectivity profiles .

What are the key takeaways for researchers entering the RXFP2 field?

For researchers entering the RXFP2 field, several key insights from recent advances deserve attention:

  • Receptor biology foundations: RXFP2 is a G protein-coupled receptor that signals primarily through Gαs-mediated cAMP production, with its primary endogenous ligand being insulin-like peptide 3 (INSL3), though it also responds to human relaxin-2 (H2 relaxin) .

  • Structural insights: The activation mechanism of RXFP2 involves multiple interaction points, including the recognition of a conserved RXXXRXX(I/V) binding cassette by the leucine-rich repeats in the ectodomain, and specific secondary interactions that differ from those of RXFP1 .

  • Therapeutic potential: RXFP2 modulation shows promise for treating bone metabolism disorders and reproductive conditions. The restricted expression profile of RXFP2 and the availability of selective agonists support the potential for targeted therapies with favorable side effect profiles .

  • Technological advances: Recent breakthroughs in developing small molecule RXFP2 agonists that are orally bioavailable with favorable pharmacokinetic properties represent a significant advance over peptide-based approaches . Similarly, protein engineering strategies to create long-half-life biologics could be applied to RXFP2-targeting therapeutics .

  • Experimental approach considerations: When designing RXFP2 studies, researchers should employ multiple complementary assays to evaluate binding, signaling, and functional responses. Species differences, though subtle, should be considered when translating findings between model systems .

The RXFP2 field offers rich opportunities for fundamental discovery and therapeutic development, with recent advances in small molecule modulators, minimized peptides, and long-acting biologics providing new tools for researchers to explore this receptor's biology and therapeutic potential.

What research gaps remain to be addressed in RXFP2 biology and pharmacology?

Despite significant progress, several important research gaps remain in RXFP2 biology and pharmacology:

  • Structural biology: High-resolution structural information for RXFP2 (through techniques like cryo-EM or X-ray crystallography) would significantly advance structure-based drug design efforts. Currently, the field lacks crystal structures of RXFP2 in complex with agonists or antagonists .

  • Signaling complexity: While cAMP production is well-established as a primary signaling pathway, a comprehensive understanding of RXFP2 signaling, including potential G protein-independent pathways, biased signaling mechanisms, and receptor internalization dynamics, remains incomplete .

  • Physiological roles beyond known functions: While RXFP2's roles in testicular descent and bone metabolism are established, its potential functions in other tissues and physiological processes require further investigation .

  • RXFP2 antagonist development: While agonist development has progressed, selective antagonists for RXFP2 could serve as valuable research tools and potential therapeutics. Truncation studies with INSL3 have identified antagonist leads, but fully optimized, drug-like antagonists remain to be developed .

  • Long-term effects of RXFP2 modulation: The consequences of chronic RXFP2 activation or inhibition on various physiological systems, including potential compensatory mechanisms, need thorough evaluation to inform therapeutic applications .

  • Translational barriers: Addressing the challenges of translating promising preclinical findings with RXFP2 modulators into clinical applications, including optimizing formulations, establishing appropriate biomarkers, and designing informative clinical trials, represents a critical research need.

Addressing these gaps will require interdisciplinary approaches combining molecular pharmacology, structural biology, medicinal chemistry, and translational research to fully realize the therapeutic potential of RXFP2 modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.