Recombinant Human Reprimo-like protein (RPRML)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RPRML; Reprimo-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RPRML
Target Protein Sequence
MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY
Uniprot No.

Target Background

Gene References Into Functions
  1. Based on embryonic and adult expression patterns, we explore the potential roles of RPRM and RPRML in cancer. Further research is anticipated to yield translational applications of this gene family, potentially as biomarkers and in the development of novel cancer therapies. PMID: 29941787
Database Links

HGNC: 32422

KEGG: hsa:388394

UniGene: Hs.367999

Protein Families
Reprimo family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is RPRML and how does it relate to other members of the Reprimo gene family?

RPRML (Reprimo-like) is a single-exon gene belonging to the Reprimo gene family . It is an important paralog of RPRM (Reprimo, TP53 Dependent G2 Arrest Mediator Homolog) . Both RPRM and RPRML share similar functional domains, with RPRML contributing to cell cycle arrest and apoptosis without forming part of a larger protein complex . The Reprimo gene family emerged through genome duplication events, and while RPRM has been more extensively studied, RPRML has distinct expression patterns and functions in vertebrate development and disease processes .

What are the structural characteristics of RPRML protein?

RPRML is primarily expressed as a protein that contributes to cell cycle arrest and apoptosis . Like its paralog RPRM, RPRML is likely secreted from cells, as recent research has demonstrated that Reprimo protein can function as an extrinsic inducer of apoptosis . The protein structure includes specific domains that allow it to interact with cell surface receptors and trigger downstream signaling pathways. While RPRM has been shown to undergo post-translational modifications in mammalian cells that are critical for its function , similar modifications may occur in RPRML, though specific structural analyses of RPRML are less documented in current literature.

How is RPRML gene expression regulated?

RPRML expression is regulated through multiple mechanisms, with epigenetic regulation being particularly significant. DNA methylation plays a crucial role in controlling RPRML expression, with hypermethylation leading to gene silencing . This methylation-mediated regulation has been extensively documented in the context of gastric cancer, where RPRML is frequently downregulated due to promoter hypermethylation . Treatment with demethylating agents such as zebularine or 5-azacytidine can restore RPRML expression, highlighting the reversible nature of this epigenetic regulation . While RPRM is known to be a direct transcriptional target of p53 , the transcription factors that regulate RPRML expression are less well characterized but may include similar tumor suppressor pathways.

What is the normal tissue distribution of RPRML expression in humans?

RPRML is predominantly expressed in the central nervous system, with lower expression levels detected in the liver and lungs . Within the nervous system, RPRML transcripts and proteins have been observed in the olfactory placode (OP) and epithelium (OE) during embryonic development . This expression pattern in the olfactory system appears to be evolutionarily conserved between zebrafish and mouse models . The tissue-specific expression of RPRML suggests it may have specialized functions in neural development and homeostasis of these particular tissues.

How does RPRML expression change during embryonic development?

RPRML shows distinctive expression patterns during embryonic development, particularly in neural and vascular tissues. In zebrafish, rprml is expressed in vascular and mesodermal-derived tissues during early development . Studies using whole mount in situ hybridization have demonstrated that rprml plays an essential role in definitive hematopoiesis by regulating the formation of erythromyeloid progenitors (EMPs) and hematopoietic stem and progenitor cells (HSPCs) . Additionally, rprml is required for proper HSPC niche formation in the caudal hematopoietic tissue (CHT) . In both zebrafish and mouse models, RPRML expression has also been detected in the developing olfactory system, suggesting a conserved role in olfactory development across vertebrate species .

What methodological approaches are most effective for detecting RPRML expression in tissue samples?

Several complementary techniques have proven effective for detecting RPRML expression:

  • RNA-level detection:

    • Whole mount in situ hybridization (WISH) for developmental studies

    • Quantitative reverse transcription PCR (qRT-PCR) for quantitative analysis

    • RNA extraction using specialized kits (e.g., E.Z.N.A total RNA kit) followed by cDNA synthesis

  • Protein-level detection:

    • Immunohistochemistry (IHC) using specific antibodies, such as rabbit polyclonal antibodies (e.g., ab204896)

    • Western blotting for quantitative protein analysis

    • Immunofluorescence for cellular localization studies

  • Epigenetic analysis:

    • Bisulfite sequencing for analyzing DNA methylation patterns in the RPRML promoter region

    • MethyLight assay for detecting circulating methylated RPRML DNA in plasma samples

For optimal results, researchers should consider combining multiple detection methods to validate their findings, particularly when studying samples with potentially low expression levels.

What is the proposed molecular function of RPRML in normal cells?

RPRML contributes to cell cycle arrest and apoptosis in normal cells . While specific molecular mechanisms of RPRML remain less characterized than its paralog RPRM, it likely functions similarly. Recent studies on RPRM have shown that it is secreted from cells and can induce apoptosis extrinsically in recipient cells by binding to specific receptors . RPRML may act through comparable pathways, potentially interacting with cell surface receptors to trigger downstream signaling cascades that regulate cell proliferation and survival. In zebrafish, rprml has been demonstrated to play an essential role in definitive hematopoiesis, specifically in the formation of erythromyeloid progenitors (EMPs) and hematopoietic stem and progenitor cells (HSPCs), as well as in proper HSPC niche formation .

How does RPRML interact with the p53 pathway?

While direct interactions between RPRML and the p53 pathway have not been extensively documented, its paralog RPRM is a well-established target gene of p53 . RPRM is activated by p53 in response to DNA damage and contributes to tumor suppression by inducing cell cycle arrest and apoptosis . Given the functional similarities between RPRM and RPRML, it is plausible that RPRML may also participate in p53-dependent cellular responses to stress and DNA damage. Recent research has revealed that Reprimo acts upstream of the Hippo-YAP/TAZ-p73 axis to induce apoptosis by transactivating various proapoptotic genes , and RPRML may function through similar mechanisms.

What experimental approaches can be used to study RPRML function in vitro?

Several experimental approaches have proven effective for studying RPRML function:

  • Gene knockdown/knockout studies:

    • Morpholino antisense oligonucleotides (MOs) for transient knockdown

    • CRISPR-Cas9 gene editing for generating stable knockout models

    • T7 endonuclease assay for validating CRISPR-Cas9-induced mutations

  • Gain-of-function studies:

    • Ectopic overexpression of RPRML in cell lines

    • Rescue experiments using mRNA generated from RPRML cDNA

  • Functional assays:

    • Colony formation and soft agar assays to assess cell proliferation and transformation

    • MTS assay to measure cell viability

    • Ki67 immunofluorescence to evaluate cell proliferation

    • Apoptosis assays to measure programmed cell death

  • Epigenetic modification studies:

    • Treatment with demethylating agents (e.g., 5-azacytidine) to restore RPRML expression

    • siRNA or CRISPR/Cas9-mediated knockout of DNA methyltransferases to investigate their role in RPRML regulation

For comprehensive analysis, a combination of these approaches should be employed, with appropriate controls to validate findings and rule out off-target effects.

What is the potential of RPRML as a biomarker for cancer detection?

RPRML has shown promise as a non-invasive biomarker for cancer detection, particularly for gastric cancer:

BiomarkerSample TypeDetection MethodDiagnostic PerformanceClinical Application
Methylated RPRML DNAPlasmaMethyLight assayAUC: 0.726 (95% CI: 0.583-0.869)Non-invasive detection of gastric cancer
RPRML protein expressionTissueImmunohistochemistryDownregulation associated with poor prognosisPrognostic indicator in advanced gastric cancer

Analysis of circulating methylated RPRML DNA in plasma samples has demonstrated potential for the non-invasive detection of gastric cancer, with an odds ratio of 9.34 (95% CI: 2.20-39.46) . While this performance is promising, the wide confidence interval indicates variability in accuracy. Research suggests that combining RPRML with other biomarkers in a multi-biomarker panel could improve reliability for cancer screening purposes . Further validation in larger, prospective cohorts is needed to establish the clinical utility of RPRML as a cancer biomarker.

How might targeting RPRML be exploited for therapeutic purposes?

Several therapeutic strategies targeting RPRML could be developed based on current understanding:

  • Epigenetic therapy: Since RPRML is frequently silenced by DNA methylation in cancer, demethylating agents such as 5-azacytidine or zebularine could potentially restore RPRML expression and its tumor suppressive function .

  • Recombinant protein therapy: Based on research with RPRM showing that it can function as a secreted protein that induces apoptosis extrinsically , recombinant RPRML protein could potentially be developed as a therapeutic agent to induce cancer cell death.

  • Gene therapy: Strategies to restore RPRML expression in cancer cells through gene delivery systems could potentially inhibit tumor growth and progression.

  • Targeting downstream pathways: Understanding the signaling pathways regulated by RPRML, such as potential involvement in the Hippo-YAP/TAZ-p73 axis , could lead to the development of small molecules targeting these pathways.

  • Radiation sensitivity modulation: Recent research on RPRM has shown its involvement in DNA damage repair and radiation sensitivity . If RPRML has similar functions, it could potentially be targeted to enhance the effectiveness of radiotherapy in cancer treatment.

What are the optimal conditions for producing and purifying recombinant human RPRML protein?

Based on methodologies used for similar proteins:

  • Expression Systems:

    • Mammalian expression systems (e.g., HEK293 cells) are recommended for recombinant RPRML production to ensure proper post-translational modifications, as research suggests these are essential for function .

    • E. coli-based systems may be suitable for structural studies but may lack critical modifications for functional studies .

  • Purification Strategy:

    • Affinity chromatography using tags (His-tag, GST-tag) followed by tag removal

    • Size exclusion chromatography for final purification and buffer exchange

    • Validate protein identity by mass spectrometry and Western blotting with RPRML-specific antibodies

  • Quality Control:

    • Circular dichroism spectroscopy to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

    • Functional assays to confirm biological activity (e.g., cell proliferation inhibition, apoptosis induction)

  • Storage Conditions:

    • For optimal stability, store purified protein in PBS with 10% glycerol at -80°C

    • Avoid repeated freeze-thaw cycles which may affect protein activity

What molecular techniques are most suitable for studying RPRML gene expression and regulation?

Several complementary techniques are recommended for comprehensive analysis:

  • Gene Expression Analysis:

    • RT-qPCR for quantitative mRNA analysis, using gene-specific primers

    • RNA-seq for genome-wide expression profiling and identification of co-regulated genes

    • Northern blotting for validating transcript size and alternative splicing variants

  • Epigenetic Regulation:

    • Bisulfite sequencing for analyzing DNA methylation patterns in the RPRML promoter region

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the RPRML promoter

    • DNA methyltransferase inhibition using 5-azacytidine or zebularine to assess methylation-dependent regulation

  • Transcriptional Regulation:

    • Luciferase reporter assays with RPRML promoter constructs to identify regulatory elements

    • EMSA (Electrophoretic Mobility Shift Assay) to confirm direct binding of transcription factors

    • Promoter deletion/mutation analysis to map critical regulatory regions

  • Post-transcriptional Regulation:

    • RNA stability assays using actinomycin D to determine mRNA half-life

    • Polysome profiling to assess translational efficiency

    • miRNA target prediction and validation to identify potential miRNA-mediated regulation

What animal models are suitable for in vivo studies of RPRML function?

Based on the literature, several animal models have proven valuable for RPRML research:

  • Zebrafish Model:

    • Advantages: Transparency allows visualization of developing tissues; amenable to genetic manipulation; rapid development

    • Applications: Successful use in studying rprml function in hematopoiesis and neural development

    • Methods: Morpholino-mediated knockdown; CRISPR-Cas9 gene editing; transgenic reporter lines (e.g., Tg(fli1:GFP))

    • Readouts: Whole mount in situ hybridization; confocal microscopy; functional hematopoiesis assays

  • Mouse Model:

    • Advantages: Mammalian physiology; complex organs systems similar to humans

    • Applications: RPRML knockout mice for studying development and disease susceptibility

    • Methods: Conventional knockout; conditional knockout; xenograft models for cancer studies

    • Readouts: Histopathology; immunohistochemistry; functional assays; tumor formation studies

  • Cell Line Xenografts:

    • Applications: Testing the effect of RPRML manipulation on tumor growth in vivo

    • Methods: RPRML-overexpressing or knockout cells implanted into immunodeficient mice

    • Readouts: Tumor growth kinetics; metastasis formation; response to therapies

When selecting an animal model, researchers should consider the specific research question, the relevant physiological context, and the availability of genetic tools and reagents for RPRML manipulation in that model system.

How can researchers resolve contradictory findings in RPRML functional studies?

Contradictory findings in RPRML research may arise from several sources:

  • Model-specific differences:

    • Systematically compare results across different model systems (cell lines, zebrafish, mouse models)

    • Consider species-specific differences in RPRML function and regulation

    • Document cell type-specific effects, as RPRML may function differently in various cellular contexts

  • Methodological variations:

    • Standardize experimental protocols, particularly for gene knockdown/knockout approaches

    • Compare morpholino-based knockdown with CRISPR-Cas9 knockout, as these may yield different phenotypes due to genetic compensation mechanisms

    • Perform rescue experiments to confirm specificity of observed phenotypes

  • Analytical approaches:

    • Employ multiple complementary techniques to validate findings

    • Consider dose-dependent and temporal effects of RPRML manipulation

    • Account for potential off-target effects of genetic manipulation tools

  • Data integration strategies:

    • Utilize multi-omics approaches to understand RPRML in a systems biology context

    • Apply statistical methods appropriate for integrating diverse datasets

    • Consider developing computational models to reconcile apparently contradictory findings

What are the emerging technologies and approaches for studying RPRML's role in cancer biology?

Several cutting-edge technologies are advancing RPRML research in cancer biology:

  • Single-cell technologies:

    • Single-cell RNA-seq to characterize RPRML expression heterogeneity within tumors

    • Single-cell ATAC-seq to map chromatin accessibility at the RPRML locus

    • Spatial transcriptomics to analyze RPRML expression in the context of tumor microenvironment

  • 3D organoid models:

    • Patient-derived organoids to study RPRML function in a physiologically relevant context

    • CRISPR-engineered organoids with RPRML knockout or overexpression

    • Co-culture systems to investigate cell-cell interactions mediated by secreted RPRML

  • Liquid biopsy approaches:

    • Improved methods for detecting circulating methylated RPRML DNA

    • Integration of RPRML methylation status with other circulating biomarkers

    • Longitudinal monitoring of RPRML methylation during treatment and disease progression

  • Targeted protein degradation:

    • Development of proteolysis-targeting chimeras (PROTACs) to modulate RPRML protein levels

    • Reversible chemical genetic systems for temporal control of RPRML function

  • AI and machine learning:

    • Predictive models of RPRML regulation and function

    • Integration of multi-omics data to identify novel RPRML-associated pathways

    • Drug repurposing strategies targeting the RPRML pathway

What are the most significant knowledge gaps in current understanding of RPRML biology?

Despite progress in RPRML research, several critical knowledge gaps remain:

  • Structural biology:

    • Detailed three-dimensional structure of RPRML protein remains undetermined

    • Structural basis for RPRML interactions with potential binding partners

    • Post-translational modifications and their impact on RPRML function

  • Signaling mechanisms:

    • Complete characterization of RPRML receptors and binding partners

    • Downstream signaling pathways activated by RPRML

    • Crosstalk between RPRML and other tumor suppressor pathways

  • Physiological roles:

    • Functions of RPRML beyond cancer biology, particularly in the nervous system

    • Developmental roles of RPRML in tissues where it is normally expressed

    • Potential involvement in non-cancer pathologies

  • Evolutionary biology:

    • Evolutionary history and functional divergence within the Reprimo gene family

    • Species-specific differences in RPRML function and regulation

    • Comparative analysis of RPRML and RPRM functions across vertebrates

  • Therapeutic applications:

    • Development of RPRML-based cancer therapies

    • Biomarker validation in large prospective clinical cohorts

    • Strategies to modulate RPRML expression or function for therapeutic benefit

Addressing these knowledge gaps will require interdisciplinary approaches combining molecular biology, structural biology, systems biology, and clinical research to fully understand RPRML biology and harness its potential for biomedical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.