Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Human respiratory syncytial virus A (strain rsb6256)
Target Names
G
Target Protein Sequence
MSKTKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAII FIASANHKVTLTTAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQPTTTPAPTTP SAESTPQSTTVKTKNTTTTQIQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNP TCWAICKRIPNKKPGKKTTTKPTKKPTIKTTKKDLKPQTTKPKEVLTTKPTEKPTINTTR TNIRTTLLTTNTTGNPEYTSQKETLHSTSPEGNPSPSQVYTTSEYPSQPPSPSNTTN
Uniprot No.

Target Background

Function
This protein mediates virion attachment to the host cell membrane via interaction with heparan sulfate, initiating infection. It also interacts with the host CX3CR1 receptor (for the CX3C chemokine fractalkine), modulating the immune response and facilitating infection. Unlike other paramyxovirus attachment proteins, it lacks neuraminidase and hemagglutinating activities. Furthermore, it helps the virus evade antibody-dependent replication restriction by acting as an antigen decoy and by modulating the activity of leukocytes expressing Fc-gamma receptors.
Protein Families
Pneumoviruses glycoprotein G family
Subcellular Location
[Isoform Membrane-bound glycoprotein G]: Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.; [Isoform Secreted glycoprotein G]: Secreted.

Q&A

What is the structure and function of RSV glycoprotein G?

RSV glycoprotein G is a type II transmembrane glycoprotein expressed on the surface of respiratory syncytial virus that functions primarily in viral attachment to host cells. The protein contains an ectodomain with a central conserved domain (CCD) flanked by variable N-terminal and C-terminal regions. The protein's calculated molecular weight is approximately 26.2 kDa, but it migrates as a 60-94 kDa protein on SDS-PAGE due to extensive glycosylation . The G protein is critical for viral adhesion to host cells via interactions with cellular glycosaminoglycans, particularly heparan sulfate, which serves as a primary attachment receptor .

How are recombinant RSV G proteins produced for research applications?

Recombinant RSV G protein can be produced using either mammalian or prokaryotic expression systems. For mammalian expression, HEK293 cells are commonly used to express the ectodomain (amino acids 67-297) with a C-terminal polyhistidine tag, which allows for proper glycosylation similar to the native protein . For prokaryotic expression, a novel approach involves expressing the G protein ectodomain in E. coli, which can be purified using a two-step process involving Ni-NTA affinity chromatography followed by DEAE weak anion-exchange chromatography from the supernatant after cell lysis . Alternatively, higher yields can be obtained by purifying the denatured form from solubilized inclusion bodies using Ni-NTA affinity chromatography, though this requires refolding steps .

How does glycosylation affect RSV G protein structure and function?

Glycosylation significantly impacts the RSV G protein's apparent molecular weight, causing it to migrate at 60-94 kDa on SDS-PAGE despite having a calculated mass of only 26.2 kDa . These post-translational modifications are crucial for proper protein folding and biological function. The extensive glycosylation creates conformational epitopes that are recognized by the immune system and influences the protein's interaction with cellular receptors. When designing studies using bacterially-produced unglycosylated G protein, researchers must consider how the lack of glycosylation might affect antigenic presentation and immunogenicity compared to mammalian-expressed, fully glycosylated versions .

What are the key differences between RSV subgroups A and B G proteins?

RSV exists as two major antigenic subgroups, A and B, with the greatest sequence divergence occurring in the G protein, which shares only 55% amino acid identity between the subgroups . The sequence diversities are particularly pronounced in the second hypervariable region of the G protein. RSV B strains frequently exhibit mutations in the G protein stop codon, with 22.1% of samples showing a mutation resulting in a 7-amino acid extension (Q/K-R-L-Q-S-Y-H/A) . Additionally, RSV B can occasionally demonstrate premature stop codons that shorten the G protein by 7 amino acids (deleting "P-S-T-S-N-S-T") . These structural differences contribute to antigenic drift and impact immune recognition, potentially affecting vaccine design and efficacy.

What quality control measures are essential when working with recombinant RSV G protein?

Quality control for recombinant RSV G protein should include multiple analytical techniques:

  • SDS-PAGE to confirm purity (>90% is standard) and molecular weight

  • Dynamic light scattering (DLS) to verify protein homogeneity

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Fluorescence and absorbance spectroscopy to evaluate tertiary structure

  • Functional binding assays to confirm interaction with known ligands such as heparan sulfate

  • Immunological assays to verify antigenic epitope preservation

  • Stability testing at various pH conditions to determine optimal storage parameters

For mammalian-expressed proteins, additional tests should verify proper glycosylation patterns, which can be assessed through glycosidase treatments followed by shifts in electrophoretic mobility.

How do RSV G protein-based vaccines induce protective immunity?

RSV G protein-based vaccines induce protective immunity through multiple mechanisms. When mice are vaccinated with recombinant G protein, they generate antibodies that bind to fully glycosylated G protein and intact RSV virion particles . While these antibodies may show minimal in vitro neutralization compared to anti-F antibodies, they still significantly reduce viral replication in both the nasal cavity and lungs upon challenge . Protection correlates with serum antibody binding to virus particles rather than neutralization titers alone. Importantly, protective antigenic sites exist throughout the G protein, including regions outside the central conserved domain (CCD) . Vaccination with G protein constructs lacking the CCD (REG ΔCCD) results in very low Th2/Th1 cytokine ratios in the lungs after challenge, suggesting a balanced immune response that may reduce the risk of enhanced disease .

What biophysical techniques are most useful for characterizing RSV G protein structure?

Several complementary biophysical techniques are valuable for characterizing RSV G protein structure:

  • Circular dichroism (CD) spectroscopy - Evaluates secondary structure elements and thermal stability

  • Fluorescence spectroscopy - Assesses tertiary structure and conformational changes

  • Absorbance spectroscopy - Monitors protein concentration and aggregation state

  • Dynamic light scattering (DLS) - Confirms protein homogeneity and detects aggregation

  • Isothermal titration calorimetry (ITC) - Quantifies binding thermodynamics with ligands like heparan sulfate

  • Microscale thermophoresis (MST) - Measures binding affinities in solution

  • pH stability studies - Determines optimal conditions for storage and handling

These techniques provide crucial information about protein folding, stability, and functional activity that guides vaccine formulation and immunological studies.

What are the mechanisms behind G protein vaccine-induced enhanced respiratory disease (ERD)?

G protein vaccine-induced enhanced respiratory disease (ERD) involves complex immunopathological mechanisms. When mice immunized with recombinant G protein are challenged with RSV, they can exhibit lung weight gain, tissue damage, and increased infiltration of eosinophils, neutrophils, and CD4+ T cells into the lungs . Research using lung weight gain as an endpoint for ERD has revealed that CD4+ T cells, rather than eosinophils or neutrophils, are primarily responsible for the pathology . Specifically, T helper 2 (Th2) cell-mediated IL-13 production induces mucin hypersecretion, which contributes to lung weight gain and respiratory distress . This mechanism differs from the classic eosinophilic infiltration previously assumed to be the primary cause of ERD, suggesting that therapeutic strategies targeting the IL-13 pathway might reduce vaccine-associated ERD while maintaining protective immunity.

How can G protein constructs be designed to minimize ERD risk while maintaining immunogenicity?

Several strategies can be employed to design G protein constructs that minimize ERD risk:

  • Deletion of specific regions associated with Th2 bias, while preserving protective epitopes

  • Use of CCD-deleted G ectodomain (REG ΔCCD), which induces low Th2/Th1 cytokine ratios after challenge

  • Inclusion of adjuvants that promote Th1-biased responses

  • Targeted mutation of amino acids within epitopes that trigger pathological T cell responses

  • Combination with other RSV antigens (like F protein) to broaden immune responses

Recent progress has shown that optimized recombinant G protein vaccines with reduced lung pathogenesis following RSV challenge have been developed, some of which have advanced to clinical trials . The goal is to induce protective antibody responses without triggering the IL-13-mediated mucin hypersecretion that contributes to ERD pathology.

What are the antigenic site variations observed in circulating RSV strains that affect G protein vaccines?

Current surveillance of circulating RSV strains reveals ongoing evolution of the G protein, with significant implications for vaccine design. For RSV A, mutations occur predominantly in the second hypervariable region, while RSV B shows more extensive variations . In RSV B, 22.1% of samples exhibit mutations in the G stop codon that extend the protein by 7 amino acids . Additionally, RSV B strains display greater changes at F antigenic sites compared to RSV A, particularly at sites V (L172Q/S173L at 99.6%), Ø (I206M/Q209K at 18.6%), and IV (E463D at 7%) .

A comprehensive analysis of these variations is essential for effective vaccine design, as shown in the table below:

RSV TypeCommon Mutation SitesFrequencyFunctional Impact
RSV ASecond hypervariable regionVariableAltered antibody recognition
RSV AStop codon (T→L extension)0.5%+1 amino acid extension
RSV BStop codon (T→Q mutation)22.1%+7 amino acid extension
RSV BPremature stop codon0.7%7 amino acid deletion
RSV BAntigenic site V99.6%Potential immune escape

This continual evolution underscores the importance of ongoing surveillance for vaccine development strategies .

How does the deletion of the G gene affect RSV vaccines and what can we learn from these models?

Studies with G gene deletion mutants provide valuable insights for vaccine development. A recombinant RSV lacking the G gene (ΔG) has been shown to induce long-lasting protection against RSV challenge in cotton rats, despite the absence of G-specific immunity . In the bovine model, a recombinant bovine RSV deletion mutant exclusively lacking the G gene protected calves against challenge virus replication . These findings suggest that G protein may not be absolutely required for protective immunity, though its inclusion may broaden protection.

The recovered ΔG viruses express all major RSV structural proteins (F, N, P, and M) except G, confirming successful deletion . When verified by Western blotting and immunostaining, cells infected with ΔG showed no G protein expression . These G-deleted constructs help researchers understand the relative contributions of different viral proteins to immunity and could inform the development of live attenuated vaccine candidates with improved safety profiles.

What methods are used to evaluate the interaction between RSV G protein and cellular receptors?

Several sophisticated biophysical techniques can quantitatively characterize the interaction between RSV G protein and cellular receptors like heparan sulfate:

  • Isothermal Titration Calorimetry (ITC) - Provides direct measurement of binding thermodynamics, including association constants (Ka), enthalpy changes (ΔH), and binding stoichiometry

  • Microscale Thermophoresis (MST) - Measures binding affinities based on changes in the movement of molecules in temperature gradients, requiring minimal sample amounts

  • Surface Plasmon Resonance (SPR) - Allows real-time analysis of binding kinetics (kon and koff rates)

  • Fluorescence-based binding assays - Can be used to study competitive binding interactions

  • Cell-based attachment assays - Evaluate the functional relevance of specific binding interactions

These techniques reveal important structure-function relationships that guide the rational design of G protein-based therapeutics and vaccines with optimized receptor-binding properties.

How do vaccination protocols affect the immune response to RSV G protein?

Vaccination protocols significantly impact immune responses to RSV G protein. In standard mouse models, subcutaneous administration of 1 μg of G protein (either alone or with 50 μg of Alhydrogel adjuvant) is typically delivered in 50 μL of PBS at the base of the tail on days 0 and 21 . This protocol induces G-specific IgG, which can be measured from plasma samples collected from the cheek vein on day 28 .

For challenge studies, mice are typically challenged intranasally with 1.0 × 10^5 PFU of RSV in 30 μL of PBS (15 μL to each nostril) under anesthesia on day 31 . Variations in this protocol—including adjuvant selection, dosing schedule, and route of administration—can significantly alter the balance between protective immunity and pathological responses. For example, mucosal delivery might enhance local immunity but could potentially increase the risk of inflammatory responses in the respiratory tract.

What role do T helper cells play in G protein vaccine-induced immunopathology?

T helper cells, particularly Th2 cells, play a central role in G protein vaccine-induced immunopathology. Research has demonstrated that CD4+ T cells infiltrating the lungs after RSV challenge in G protein-vaccinated mice are primarily responsible for lung weight gain, a key indicator of enhanced respiratory disease (ERD) . These Th2 cells secrete IL-13, which induces mucin hypersecretion, contributing to airway obstruction and respiratory distress .

The immune response can be analyzed by collecting lungs and bronchoalveolar lavage fluid (BALF) samples after challenge and measuring cellular infiltration and cytokine profiles . The ratio of Th2 to Th1 cytokines serves as an important predictor of ERD risk, with higher ratios correlating with more severe pathology. Importantly, vaccination with CCD-deleted G ectodomain (REG ΔCCD) results in very low Th2/Th1 cytokine ratios in the lungs after challenge, suggesting a safer immune profile .

How can researchers measure the protective efficacy of RSV G protein vaccine candidates?

Evaluating protective efficacy of RSV G protein vaccine candidates requires a multi-parameter assessment approach:

  • Viral load reduction - Measure viral titers in both the upper respiratory tract (nasal cavity) and lower respiratory tract (lungs) following challenge

  • Serological responses - Quantify binding antibodies to both mammalian-expressed glycosylated G protein and intact RSV virions

  • Neutralization assays - Assess in vitro neutralization capacity, though G-specific antibodies may show limited activity in standard neutralization assays

  • Histopathological examination - Evaluate lung tissue for inflammation, eosinophil infiltration, and mucus production

  • Weight loss and clinical scoring - Monitor for disease symptoms in animal models

  • Cytokine profiling - Measure the balance between Th1 and Th2 cytokines in lung tissue and BALF

  • T cell responses - Characterize T cell subsets and their cytokine production by flow cytometry

The most predictive endpoint appears to be the ability to control viral replication in vivo, which correlates with serum antibody binding to virus particles rather than in vitro neutralization alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.