Recombinant Human respiratory syncytial virus B Major surface glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Human respiratory syncytial virus B (strain B1)
Target Names
G
Target Protein Sequence
MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAII FIISANHKVTLTTVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSP NTKSETHHTTAQTKGRTTTSTQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQ LCKSICKTIPSNKPKKKPTIKPTNKPTTKTTNKRDPKTPAKTTKKETTTNPTKKPTLTTT ERDTSTSQSTVLDTTTLEHTIQQQSLHSTTPENTPNSTQTPTASEPSTSNSTQNTQSHA
Uniprot No.

Target Background

Function
The major surface glycoprotein G of human respiratory syncytial virus (RSV) plays a critical role in viral attachment and entry into host cells. It mediates virion attachment to the host cell membrane via interaction with heparan sulfate, initiating infection. Furthermore, G protein interacts with host CX3CR1 (the fractalkine receptor) to modulate the immune response and facilitate infection. Unlike other paramyxovirus attachment proteins, G lacks neuraminidase and hemagglutinating activities. Importantly, G contributes to viral evasion of antibody-mediated restriction of replication by acting as an antigen decoy and modulating the activity of Fc-gamma receptor-bearing leukocytes.
Gene References Into Functions
  1. Human respiratory syncytial virus (RSV) expressing the F protein of strain 2-20 exhibited a high dependence on G for binding, entry, and infection. (PMID: 26468535)
  2. Positive selection was observed in the G protein of RSV subtypes A and B, with RSV-A showing a slower evolutionary rate than RSV-B in South Africa (1999-2012). (PMID: 24265482)
  3. The secreted G protein of RSV antagonizes antibody-mediated restriction of replication involving macrophages and complement. (PMID: 22837211)
  4. Analysis of RSV-A genetic variability in Ontario revealed that a 23-amino acid duplication in the G gene introduces a repeat of seven potential O-glycosylation sites. (PMID: 22470426)
  5. Intrapatient variability in the G protein gene was examined using population and single-genome sequencing, revealing a 60-nucleotide duplication in the G protein gene of group B RSV in three patients. (PMID: 20660195)
  6. RSV G protein induces interleukin-1α, CC, and CXC chemokine responses in normal human bronchoepithelial cells. (PMID: 20205592)
  7. This study confirmed the presence of the 60-nucleotide duplication in the G protein gene of human RSV type B strains in Australia. (PMID: 18752134)
Database Links

KEGG: vg:1489824

Protein Families
Pneumoviruses glycoprotein G family
Subcellular Location
[Isoform Membrane-bound glycoprotein G]: Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.; [Isoform Secreted glycoprotein G]: Secreted.

Q&A

What are the key structural features that differentiate RSV glycoprotein G from other viral attachment proteins?

RSV glycoprotein G is structurally unique among viral attachment proteins with several distinguishing features:

  • Approximately 60% of its mass is contributed by carbohydrate, predominantly in the form of O-linked oligosaccharides

  • Unlike typical viral membrane proteins, G lacks both a hydrophobic N-terminal signal sequence and a C-terminal anchor region

  • It contains only one significant hydrophobic domain, located between residues 38-66, which serves both as a signal peptide and membrane anchor

  • Unlike other paramyxovirus attachment proteins, RSV G lacks both neuraminidase and hemagglutinating activities

  • The protein consists of a N-terminal cytoplasmic domain, a hydrophobic transmembrane domain, and two mucin-like regions surrounding a central conserved disulphide-bonded noose that protrudes from the virus

These structural characteristics make RSV G an unusual viral glycoprotein that employs different mechanisms for synthesis, processing, and membrane insertion compared to more conventional viral surface proteins.

How does glycoprotein G differ between RSV subgroups A and B?

RSV subgroups A and B exhibit significant differences in their G glycoproteins:

  • The glycoprotein G is the primary determinant of antigenic differences between the two subgroups

  • RSV B shows greater sequence diversity in the G protein, with multiple forms of different lengths compared to RSV A

  • In RSV B, mutations in the stop codon (TAA to CAA) resulting in a 7-amino acid extension (Q/K-R-L-Q-S-Y-H/A) have been observed in 22.1% of samples

  • Conversely, some RSV B strains (0.7%) show premature stop codons that shorten the G protein by 7 amino acids

  • The duplicated regions in RSV B G protein show significant variation with combinations like "TV-IA" (49.9%) and "TV-IV" (12.3%), while only 1.1% maintain the reference "TV-TV" sequence

These variations reflect evolutionary adaptations and immune pressure, with constant changes occurring particularly in the second hypervariable region of the G protein .

What expression systems have been successfully employed for recombinant RSV glycoprotein G production?

Several expression systems have proven effective for producing recombinant RSV G protein:

Vaccinia Virus Vector System:

  • Full-length cDNA copies of G protein mRNA can be inserted into vaccinia virus DNA genome adjacent to a strong vaccinia promoter

  • The recombinant is typically inserted within the thymidine kinase gene, allowing for TK- selection

  • The resulting protein is indistinguishable from authentic RSV G protein, showing proper glycosylation and membrane localization

Baculovirus-Infected Insect Cell System:

  • The surface-exposed portion of RSV G can be effectively expressed in baculovirus-infected insect cells

  • This system is particularly useful for producing soluble forms of the protein for antibody studies

Mammalian Cell Expression:

  • HEK293 cells have been used to express recombinant RSV A glycoprotein G with a C-terminal human Fc-tag

  • This approach allows for production of a properly folded and glycosylated protein, buffered in DPBS at pH 7.4

When selecting an expression system, researchers should consider the specific requirements of their experimental design, particularly whether native glycosylation patterns are essential for the intended application.

To what extent is glycoprotein G necessary for RSV infection and what methodologies can assess its contribution?

The necessity of G protein for RSV infection varies by strain and experimental system:

Evidence for G Protein Dispensability:

  • G-null RSV variants can replicate efficiently in several cell lines

  • Laboratory-adapted strains like A2 show less dependence on G protein than clinical isolates

Methodologies to Assess G Contribution:

  • Generation of G-null Mutants:

    • Create recombinant viruses lacking G expression by mutating both initiation methionines to isoleucine and introducing a premature stop codon

    • Compare with wild-type viruses expressing both G and F from the same strain

  • Quantitative Comparative Analysis:

    • Measure virus cell binding efficiency using radiolabeled viruses

    • Assess entry kinetics through time-course experiments

    • Compare infectivity in various cell types using plaque assays

    • Evaluate in vitro growth kinetics to determine replication efficiency

  • Strain-Dependent Functional Assessment:

    • Generate chimeric viruses with G and F proteins from different strains (e.g., laboratory A2 strain vs. clinical isolate 2-20)

    • Compare G-null variants expressing F proteins from different strains to isolate strain-specific G dependence

Research indicates that clinical isolates (like 2-20) show greater dependence on their G protein than laboratory strains, suggesting that the requirement for G has been underestimated in previous studies using adapted strains .

What is the role of the secreted form of glycoprotein G in RSV pathogenesis and immune evasion?

The secreted form of glycoprotein G (sG) plays critical roles in RSV pathogenesis and immune evasion:

Immune Evasion Mechanisms:

  • sG functions as an antigenic decoy to divert the host immune response away from membrane-bound G (mG) on virions

  • It can interfere with antibody-dependent restriction of viral replication

  • In experimental models, wild-type RSV (expressing both sG and mG) shows increased resistance to neutralization by RSV antibodies compared to mutants expressing only mG

Immunomodulatory Effects:

  • sG modulates the inflammatory leukocyte response, potentially altering disease manifestation

  • It interacts with and modifies the activity of leukocytes bearing Fc gamma receptors

Experimental Approaches to Study sG Function:

  • In vitro neutralization assays:

    • Compare wild-type RSV and mG-only RSV sensitivity to antibody neutralization in the presence or absence of sG

  • Animal models:

    • Evaluate replication of wild-type RSV versus mG-only RSV in mouse lungs after passive administration of RSV G or F antibodies

    • Analyze inflammatory responses through histopathological examination and cytokine profiling

  • Genetic manipulation:

    • Engineer recombinant RSV with Met-48-Ile and Ile-49-Val substitutions to ablate sG expression while maintaining mG expression

    • Sequence verification of mutants can be performed directly on uncloned RT-PCR products

Understanding sG's dual roles in immune evasion and immunomodulation is critical for rational vaccine design and therapeutic strategies against RSV.

How can recombinant RSV systems be designed to track viral infection patterns in vitro and in vivo?

Advanced recombinant RSV systems allow real-time tracking of viral infection through reporter gene integration:

Generation of Fluorescent Reporter RSV:

  • Genome sequencing and assembly:

    • Obtain consensus genome sequence directly from unpassaged clinical specimens

    • Assemble a full-length molecular clone without introducing mutations

  • Additional transcription unit (ATU) insertion:

    • Insert a gene encoding Enhanced Green Fluorescent Protein (EGFP) between specific viral genes

    • The optimal position is between the phosphoprotein (P) and matrix (M) genes (position 5) for RSV B

  • Recovery of recombinant virus:

    • Transfect the recombinant genome along with helper plasmids into HEp-2 cells

    • Verify expression of EGFP and authentic viral proteins by fluorescence microscopy and immunostaining

Tracking Infection Patterns:

In vitro applications:

  • Monitor infection in HEp-2 cells and well-differentiated normal human bronchial epithelial (NHBE) cells grown at air-liquid interface

  • Track cell-to-cell spread without relying on cytopathic effects

  • Visualize "comet-like" spread patterns in differentiated human airway epithelial cells

In vivo applications:

  • Perform intranasal infection of cotton rats (Sigmodon hispidus)

  • Directly visualize EGFP+ cells in nasal septum, conchae, and bronchiolar epithelial cells

  • Track virus spread in both upper and lower respiratory tracts

  • Identify infected tissues immediately after necropsy for targeted pathological assessment

This system is particularly valuable for studying wild-type RSV infection, which often lacks obvious cytopathic effects, thereby increasing the sensitivity of virus detection in pathogenesis studies .

What are the key epitopes in RSV B glycoprotein G that could serve as targets for vaccine development?

Analysis of epitopes in RSV B glycoprotein G reveals several promising targets for vaccine development:

Key Antigenic Regions:

  • The central conserved disulphide-bonded noose that protrudes from the virus surface represents a structurally preserved region

  • The exposed conserved region contains non-conformational, sequential peptide epitopes that are primary targets of natural IgG responses

  • The second hypervariable region, particularly within duplicated regions, shows significant diversity but contains strain-specific epitopes

Epitope Mapping Approaches:

  • Overlapping peptide arrays:

    • Synthesize overlapping peptides spanning the complete G protein sequence

    • Test recognition by sera from infected individuals to identify immunodominant regions

  • Mutation analysis:

    • Compare sequence variations at antigenic sites between different RSV B isolates

    • Identify changes at the F antigenic sites (particularly sites V, Ø, and IV)

    • Monitor mutations in the duplicated regions and G stop codon extensions

  • Evolutionary tracking:

    • Continuous surveillance of RSV surface glycoproteins is essential as they are constantly evolving

    • Recent data show changes at antigenic site V (L172Q/S173L at 99.6%), Ø (I206M/Q209K at 18.6%), and IV (E463D at 7%) of RSV B F

Practical Considerations for Vaccine Design:

  • Both conserved and variable epitopes should be considered in multivalent vaccine approaches

  • RSV G-derived peptides have shown promise for serological diagnosis of RSV-triggered exacerbations of respiratory diseases

  • G-specific antibodies have been found to exhibit virus-neutralizing activity

  • The natural IgG subclass reactivity profile (IgG1 > IgG2 > IgG4 = IgG3) indicates a mixed Th1/Th2 response that should be considered in vaccine adjuvant selection

How does the antibody response to RSV glycoprotein G differ from that against the fusion protein F, and what are the implications for immunity?

The antibody response against RSV glycoprotein G exhibits distinct characteristics compared to responses against the fusion protein F:

Comparative Antibody Responses:

FeatureAnti-G Antibody ResponseAnti-F Antibody ResponseImplications
MagnitudeSignificantly stronger in natural infections Lower in natural infections G may be more immunodominant in natural immunity
Target epitopesPrimarily non-conformational, sequential peptides Conformational epitopes Different strategies needed for vaccine design
Recognition patternScattered but constant over time More focused on specific sites G-based immunity may be broader
Neutralizing capacityPresent in strongly neutralizing sera Primary target for therapeutic antibodies (e.g., palivizumab) Both contribute to protective immunity
Cross-reactivityMore subgroup-specific More conserved across subgroups F better for broad protection across subgroups

Methodological Approaches to Study Antibody Responses:

  • Recombinant protein expression:

    • Express the surface-exposed part of G in baculovirus-infected insect cells

    • Express F0 protein for comparative analysis

  • Natural response monitoring:

    • Track G-specific IgG levels in adult subjects over one year

    • Measure G-specific IgG increases in children after wheezing attacks

  • Subclass analysis:

    • Determine IgG subclass profiles (IgG1 > IgG2 > IgG4 = IgG3) to characterize Th1/Th2 balance

Implications for Immunity and Vaccine Development:

  • G-specific immunity appears to be important but underappreciated in natural protection against RSV infection

  • The strong antibody response against G suggests it should be reconsidered as a vaccine candidate

  • The mixed Th1/Th2 response profile may help avoid the enhanced respiratory disease observed in early F-only vaccine attempts

  • G-specific antibodies increase after RSV-triggered wheezing episodes, making G useful for serological diagnosis

  • An optimal vaccine approach may need to incorporate both G and F to provide comprehensive immunity

What mechanisms drive the evolutionary dynamics of RSV glycoprotein G, and how do these impact immune escape?

The evolutionary dynamics of RSV glycoprotein G involve several sophisticated mechanisms:

Molecular Evolution Mechanisms:

  • Nucleotide Substitutions:

    • Point mutations in the stop codon (TAA to CAA) result in 7-amino acid extensions in 22.1% of RSV B samples

    • Conversely, premature stop codons (GAG to TAG) can shorten the protein by 7 amino acids

  • Duplication Events:

    • RSV B contains duplicated sequence regions "SLDTT" and "STVLDTT"

    • Variations within these duplicated regions create distinct patterns: "TV-IA" (49.9%), "TV-IV" (12.3%), and "TV-TV" (1.1%)

  • Selective Pressure:

    • Immune pressure on the G protein has led to continued evolution, particularly in the second hypervariable region

    • Multiple strains circulate simultaneously, showing constant evolutionary changes

Impact on Immune Escape:

  • The sequence diversity in the G protein's second hypervariable region, especially in the duplicated regions, likely assists in immune evasion

  • The 7-amino acid extension observed in 22.1% of RSV B samples may alter antibody recognition sites

  • The secreted form of G protein serves as an antigenic decoy, further enhancing immune evasion

  • Changes in the G protein could explain why certain RSV B variants (like BA viruses) have outcompeted other subgroup B HRSVs

Research Methodologies for Studying Evolution:

  • Sequence Analysis Approaches:

    • Monitor sequence variations over time through continuous surveillance

    • Compare changes across geographic locations to identify regional evolutionary patterns

    • Apply computational phylogenetics to track emergence of new variants

  • Functional Assessment of Variants:

    • Generate recombinant viruses with different G protein variants

    • Compare fitness between viruses with and without specific G protein modifications

    • Evaluate antibody neutralization escape capabilities of different variants

Understanding these evolutionary dynamics is crucial for vaccine design, as vaccines targeting the G protein must account for its rapid evolution and strain diversity.

What are the most effective in vitro and in vivo models for studying RSV B glycoprotein G function, and how do they compare?

Several experimental models offer complementary insights into RSV B glycoprotein G function:

In Vitro Models:

Model SystemAdvantagesLimitationsBest Applications
HEp-2 cells - Support efficient virus replication
- Allow for genetic stability assessment
- Easily transfected for virus recovery
- Not physiologically relevant to respiratory epithelium
- May select for laboratory adaptation
- Virus propagation
- Initial recovery of recombinant viruses
- Basic virus-cell interaction studies
Well-differentiated normal human bronchial epithelial (wd-NHBE) cells - Contain ciliated cells (natural RSV targets)
- Allow air-liquid interface (ALI) culture
- Display "comet-like" viral spread patterns
- Donor variability
- More technically challenging
- Higher cost
- Studying physiologically relevant infection
- Natural viral spread patterns
- Bridge between in vitro and in vivo studies
Primary human airway epithelial (HAE) cells - Recapitulate directional spread driven by ciliary beating
- Model natural target cells
- Limited availability
- Short lifespan
- Authentic virus-host cell interactions
- Ciliary function effects

In Vivo Models:

ModelAdvantagesLimitationsBest Applications
Cotton rat (Sigmodon hispidus) - Highly susceptible to RSV
- Supports replication of clinical isolates
- Allows tracking with EGFP-expressing viruses
- Not a natural host
- Some differences in immune response from humans
- Pathogenesis studies
- Virus spread in respiratory tract
- Preclinical testing of antivirals
Mouse models - Well-characterized immune system
- Many genetic tools available
- Lower cost and easier handling
- Less permissive to RSV infection
- May require adaptation of virus
- Immunological studies
- Antibody response evaluation
- Testing immunomodulatory effects of sG
Human volunteers - Natural host
- Most clinically relevant
- Ethical limitations
- Restricted to wild-type strains
- Limited experimental interventions
- Clinical outcomes
- Evaluation of antivirals
- Natural immune response

Methodological Considerations:

  • For studying wild-type viruses with minimal adaptation:

    • Obtain genome sequences directly from unpassaged clinical specimens

    • Generate recombinant viruses from these sequences

    • Use EGFP-expressing viruses to track infection in the absence of cytopathic effects

  • For comparative studies between subgroups:

    • Include both subgroup A and B viruses, as most research has historically focused on subgroup A

    • Consider strain-specific differences in G protein contribution to infection

The most effective approach is a multi-model strategy, starting with HEp-2 cells for initial characterization, followed by wd-NHBE cells for physiologically relevant in vitro studies, and culminating in cotton rat models for in vivo validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.