Recombinant Human Reticulon-1 (RTN1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted according to your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us to facilitate preferential development.
Synonyms
RTN1; NSP; Reticulon-1; Neuroendocrine-specific protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-776
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAAS REAGSGPARQSPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDS TYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNK ILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPD KPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKT PEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGSISEDELITAI KEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEES PKREQDSPPMKPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGD GALEPETPMLPRKPEEDSSSNQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQ TGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAY LELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFN GLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
Uniprot No.

Target Background

Function
Inhibits amyloid precursor protein processing, likely by blocking BACE1 activity.
Gene References Into Functions

Reticulon 1A (RTN1A) Functional Insights:

  1. RTN1A functions as both an endoplasmic reticulum (ER)-shaping protein and a protein mediating ER-mitochondria contact. (PMID: 28760823)
  2. Genetic association exists between RTN1 variants and end-stage kidney disease in various populations. (PMID: 26496126)
  3. RTN1A is a key mediator of proteinuria-induced tubular cell toxicity and renal fibrosis. (PMID: 26739891)
  4. RTN1A contributes to kidney disease progression by inducing ER stress. (PMID: 26227493)
  5. MANF interacts with RTN1-C. (PMID: 25543119)
  6. RTN1-C regulates ER-mitochondria cross-talk, maintaining the function of inter-organelle contacts. (PMID: 25573430)
  7. RTN1-C influences PDI redistribution and activity within ER vesicles by modulating S-nitrosylation levels. (PMID: 23559015)
  8. A potential metal ion binding motif (HxE/D) has been identified in the RTN1-C C-terminal region. (PMID: 22522967)
  9. RTN-1C modulates gene expression, impacting transcripts linked to neurodegenerative disorders. (PMID: 20708685)
  10. RTN1-A and RTN1-B share an N-terminal 168-amino acid region potentially regulating endocytic processes. (PMID: 14995077)
  11. Reticulon 1 interacts specifically with spastin. (PMID: 16602018)
  12. The ER localization signal of human RTN1-A has been analyzed. (PMID: 17303085)
  13. RTN-1C modulates cellular sensitivity to apoptotic pathways, suggesting its potential as a drug target. (PMID: 17596210)
  14. The RTN1-C C-terminal region binds nucleic acids. (PMID: 19140693)
  15. RTN-1C binds DNA; its function is regulated by acetylation and coupled to HDAC inhibition. (PMID: 19668229)
Database Links

HGNC: 10467

OMIM: 600865

KEGG: hsa:6252

STRING: 9606.ENSP00000267484

UniGene: Hs.368626

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.

Q&A

What is Reticulon-1 (RTN1) and what are its major isoforms?

RTN1 belongs to the reticulon family of proteins, which primarily localize to the endoplasmic reticulum. In mammals, there are three major isoforms: RTN1A, RTN1B, and RTN1C. These isoforms share the same C-terminal domain but differ in their N-terminal regions, with RTN1A having the longest N-terminal region (approximately 400 amino acids longer than RTN1B) . The C-terminal domain contains the reticulon homology domain (RHD), which is characterized by two unusually long hydrophobic regions separated by a 66 amino-acid hydrophilic loop .

The specific protein characteristics of recombinant human RTN1 include:

PropertySpecification
Target NameReticulon 1 (RTN1)
SynonymsNSP; Neuroendocrine Specific Protein
SpeciesHuman (Homo sapiens)
Accession NumberQ16799
Gene ID6252
Expression RegionAla589~Glu776
Theoretical MW51kDa
Purity>90% by SDS-PAGE
HostE. coli
TagN-terminal His and GST Tag

How does RTN1 compare to other reticulon family members?

In mammals, there are four reticulon genes encoding RTN1-4. The reticulon homology domains (RHDs) of RTN1, RTN3, and RTN4 share high sequence identity at the amino acid level (average 73%), whereas RTN2 has only 52% identity with human RTN4 . Across phyla, the second hydrophobic region of the RHD is the most highly conserved, followed by the first hydrophobic region, with the carboxyl terminus being the least conserved .

Among the three isoforms of RTN1, only RTN1A appears to be significantly induced in diseased kidneys and mediates ER stress and apoptosis in kidney cells . This contrasts with RTN4 (also known as Nogo), which is well-known for its role in inhibiting axonal regeneration in the central nervous system.

What is the membrane topology of RTN1 and how does it relate to its function?

The membrane topology of reticulons, including RTN1, is complex and may vary depending on cellular context. Studies on RTN4 suggest multiple possible conformations:

  • A horseshoe configuration where both N-terminus and C-terminus are in the cytoplasm

  • A conformation where both termini are in the ER lumen

  • A model where most of both the N-terminal domain and the 66-loop are cytoplasmic

These multiple conformations may enable reticulons to perform diverse cellular functions. For RTN1A specifically, its N-terminal and C-terminal domains interact with PERK (an ER stress sensor), and these interactions are crucial for its role in promoting ER stress . The ability to adopt different membrane topologies appears to be important for RTN1's various functions in ER morphogenesis, vesicular trafficking, and cell death pathways.

What cellular processes is RTN1 involved in?

RTN1 participates in several key cellular processes:

  • ER stress and unfolded protein response: RTN1A interacts with PERK, a key ER stress sensor, inducing ER stress responses .

  • Apoptosis: RTN1 has been shown to be involved in apoptotic pathways and potentially interacts with anti-apoptotic proteins .

  • Vesicular trafficking: RTN1 isoforms interact with components of endocytosis (RTN1A and RTN1B interact with the AP-2 adaptor complex) and exocytosis (RTN1C associates with SNARE proteins) .

  • ER morphogenesis: Like other reticulons, RTN1 plays a role in shaping ER tubules and regulating ER structure .

  • Nuclear envelope assembly: RTN proteins localize to subdomains of the nuclear envelope and may participate in nuclear envelope formation during cell division .

How is RTN1 implicated in kidney disease progression?

Research has shown that RTN1A expression is specifically upregulated in diseased kidneys from both humans and mouse models. In patients with diabetic nephropathy, RTN1A expression inversely correlates with renal function (eGFR) and serum creatinine levels, with higher expression associated with worse kidney function .

Mechanistically, RTN1A induces ER stress and apoptosis in renal cells by interacting with PERK through its N-terminal and C-terminal domains. In mouse models, knockdown of RTN1A expression attenuates:

  • ER stress and renal fibrosis in unilateral ureteral obstruction

  • ER stress, proteinuria, glomerular hypertrophy, and mesangial expansion in diabetic mice

These findings suggest that RTN1A contributes to the progression of chronic kidney disease by inducing ER stress responses and subsequent cellular damage. Immunostaining studies have shown that RTN1A expression is more pronounced in kidney biopsy samples from patients with diabetic nephropathy (DN) and HIV-associated nephropathy (HIVAN) compared to minimal change disease (MCD) and normal kidney sections .

How does RTN1 function differ between normal and pathological states?

This upregulation leads to enhanced interaction with PERK, triggering ER stress responses, promoting apoptosis, and contributing to tissue damage and fibrosis. Interestingly, the role of RTN1 in ER stress might be context-dependent and isoform-specific:

  • In kidney cells, RTN1A promotes ER stress and apoptosis

  • In plant models, RTN proteins appear to suppress ER stress

  • RTN1C, which has shorter N- and C-terminal domains, does not participate in ER stress induction in kidney cells

The long N-terminal extension of RTN1A seems critical for its pathological role in inducing ER stress through interaction with PERK .

What are effective methods for manipulating RTN1 expression in cellular and animal models?

Several approaches have been successfully used to manipulate RTN1 expression:

Overexpression systems:

  • Plasmid vectors encoding RTN1A have been used in cell lines like HK2 (human kidney) cells and podocytes to study effects on ER stress and apoptosis

  • The effectiveness of overexpression can be confirmed via western blotting

RNA interference:

  • Short hairpin RNAs (shRNAs) targeting specific regions of RTN1A have been designed and validated for knockdown experiments

  • shRNA clones CL-1 and CL-4 have shown effective knockdown of RTN1A but not RTN1C, allowing for isoform-specific studies

Animal models:

  • In vivo manipulation of RTN1 expression has been achieved in mouse models of kidney disease, including the db/db diabetic model and the unilateral ureteral obstruction (UUO) model

  • These approaches have used viral vectors to deliver shRNAs to modify RTN1 expression

Domain-specific mutations:

  • Creating mutations in the N-terminal or C-terminal domains of RTN1A that prevent interaction with PERK has been used to study the structure-function relationship in ER stress induction

What techniques are used to assess RTN1 protein interactions and localization?

Several techniques have been employed to study RTN1 interactions and localization:

Protein interaction methods:

  • Co-immunoprecipitation (Co-IP): Used to detect protein-protein interactions, such as RTN1A's interaction with PERK

  • Yeast two-hybrid screening: Identified interactions between RTN1 isoforms and components of the endocytosis adaptor complex AP-2, as well as interactions with vesicle fusion protein chaperones like β-SNAP

Localization studies:

  • Immunofluorescence and confocal microscopy: Used to visualize the subcellular localization of RTN1 isoforms in different cell types and tissues

  • Membrane topology studies: Techniques like maleimide polyethylene glycol modification of cysteines have been used to determine the orientation of reticulon proteins in membranes

Expression analysis:

  • Western blotting: Used to quantify RTN1 expression levels and detect changes in response to various stimuli or in disease models

  • Immunohistochemistry: Applied to tissue sections to assess RTN1 expression patterns in normal and diseased tissues, as demonstrated in kidney biopsy samples

  • Real-time quantitative PCR (qPCR): Used to measure mRNA expression levels of RTN1 isoforms

How do the different RTN1 isoforms contribute to cellular homeostasis and disease pathogenesis?

The three isoforms of RTN1 (RTN1A, RTN1B, and RTN1C) have distinct roles in cellular function and disease:

RTN1A:

  • With its long N-terminal domain, RTN1A is primarily implicated in ER stress induction and apoptosis, particularly in kidney disease

  • It interacts with PERK through both its N- and C-terminal domains, promoting ER stress responses

  • RTN1A expression is specifically upregulated in diseased kidneys and correlates with disease severity

RTN1B:

  • Less is known about RTN1B's specific functions

  • It has been shown to interact with components of the endocytosis machinery, suggesting a role in vesicular trafficking

RTN1C:

  • Unlike RTN1A, RTN1C does not induce ER stress in kidney cells, likely due to its shorter N- and C-terminal domains

  • RTN1C may be involved in exocytosis, as it associates with SNARE proteins like syntaxin 1, syntaxin 7, syntaxin 13, and VAMP2

  • Overexpression of RTN1C fragments has been shown to increase exocytosis rates in PC12 cells

These isoform-specific functions highlight the importance of precise targeting in therapeutic approaches. For instance, inhibiting RTN1A specifically, rather than all RTN1 isoforms, might be beneficial in treating kidney diseases while preserving normal cellular functions mediated by other isoforms.

What are the challenges in studying RTN1 function across different cell types and organisms?

Studying RTN1 across different systems presents several challenges:

Context-dependent effects:

  • RTN1's function varies significantly between cell types and organisms

  • While RTN1A promotes ER stress in mammalian kidney cells, plant RTN proteins appear to suppress ER stress

  • This context-dependency necessitates careful validation across different systems

Isoform specificity:

  • The presence of multiple isoforms with potentially different functions requires the development of isoform-specific tools and approaches

  • Antibodies that recognize only one isoform or genetic manipulations that target specific isoforms are essential

Membrane topology complexity:

  • The variable membrane topology of reticulons complicates the interpretation of functional studies

  • Specialized techniques may be required to determine protein orientation in different cellular contexts

Functional redundancy:

  • The presence of four reticulon genes (RTN1-4) in mammals, with partially overlapping functions, means that knockdown of one reticulon may be compensated by others

  • This redundancy can mask phenotypic effects in experimental models

Species differences:

  • The degree of conservation between reticulons varies across species

  • The RHDs of C. elegans and S. cerevisiae share only 15-50% identity with mammalian reticulons

  • These variations must be considered when translating findings across species

What are the implications of RTN1's role in ER stress for developing therapeutic strategies for kidney disease?

The identification of RTN1A as a mediator of ER stress and kidney disease progression has several therapeutic implications:

Target validation:

  • Knockdown of RTN1A attenuates ER stress and ameliorates kidney damage in mouse models of both unilateral ureteral obstruction and diabetic nephropathy

  • This validates RTN1A as a potential therapeutic target for kidney disease

Isoform-specific targeting:

  • Since RTN1A, but not RTN1C, induces ER stress, therapeutic strategies should aim to specifically inhibit RTN1A while preserving the functions of other isoforms

Domain-specific interventions:

  • The N-terminal and C-terminal domains of RTN1A interact with PERK to induce ER stress

  • Peptides or small molecules that disrupt these specific interactions could potentially inhibit RTN1A-mediated ER stress without affecting other RTN1 functions

Biomarker potential:

  • The correlation between RTN1A expression and kidney function suggests its potential use as a biomarker for disease progression or treatment response

  • Semi-quantitative assessment of RTN1A staining on kidney sections from patients with diabetic nephropathy demonstrated that RTN1A staining intensity in the tubular compartment inversely correlated with eGFR and serum creatinine

ER stress modulation approach:

  • The ER stress induced by RTN1A can be prevented by pretreatment with 4-phenylbutyrate (4-PBA), an inhibitor of ER stress

  • This suggests that ER stress inhibitors could be used in combination with RTN1A-targeting approaches for synergistic effects

How can recombinant RTN1 be utilized to study its function and potential therapeutic applications?

Recombinant Human Reticulon 1 (RTN1) provides a valuable tool for investigating the protein's function and developing therapeutic approaches:

Structural and functional studies:

  • Recombinant RTN1 can be used for in vitro binding assays to identify and characterize protein-protein interactions

  • The availability of purified protein (>90% by SDS-PAGE) enables structural studies using techniques like X-ray crystallography or cryo-electron microscopy

Antibody development and validation:

  • Recombinant RTN1 can serve as an antigen for generating specific antibodies against different domains or isoforms

  • These antibodies can then be used for various applications like western blotting, immunoprecipitation, and immunohistochemistry

Screening for RTN1 inhibitors:

  • Recombinant RTN1 can be used in high-throughput screening assays to identify small molecules or peptides that interfere with its interaction with PERK or other binding partners

  • Such inhibitors could have therapeutic potential in kidney disease and other conditions where RTN1 plays a pathological role

In vitro disease modeling:

  • Adding recombinant RTN1A to cell culture systems can help model ER stress responses and study the downstream effects on cellular function and viability

  • This approach allows for controlled dose-response studies and mechanistic investigations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.