Recombinant Human Reticulon-2 (RTN2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2488665
Source
in vitro E.coli expression system
Synonyms
RTN2; NSPL1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI
Quick Inquiry

Description

Cancer Metastasis

  • Gastric Cancer: Recombinant RTN2 was used to demonstrate its role in promoting metastasis via ERK signaling. Overexpression in gastric cancer cells increased migration and invasion by 2.5-fold, driven by calcium release from ER stores .

  • Mechanism: RTN2 binds inositol 1,4,5-trisphosphate receptor (IP3R), triggering Ca²⁺ efflux and epithelial-mesenchymal transition (EMT) .

Neurological Functions

  • Amyloid Regulation: RTN2 inhibits β-secretase (BACE1), reducing amyloid-β production in Alzheimer’s models .

  • Glucose Transport: Enhances SLC2A4/GLUT4 translocation to cell membranes, facilitating glucose uptake .

Functional Assays Using Recombinant RTN2

  • Calcium Imaging: RTN2 reduced RyR2-mediated Ca²⁺ oscillations in neurons by 40% .

  • Transwell Migration: Gastric cancer cells transfected with RTN2 showed 3-fold higher invasion compared to controls .

  • Co-IP/MS: Pull-down assays identified IP3R and ERK1/2 as binding partners .

Challenges and Future Directions

  • Post-Translational Modifications: Mammalian-expressed RTN2 is preferred for studies requiring phosphorylation or glycosylation .

  • Therapeutic Targeting: RTN2’s role in metastasis and amyloidogenesis highlights its potential as a drug target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTN2; NSPL1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RTN2
Target Protein Sequence
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPR ELTFSYIAFDGVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPE PGRRGDPDTAPPSERPLEDLRLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLE TGEAGEELDLRLRLAQPSSPEVLTPQLSPGSGTPQAGTPSPSRSRDSNSGPEEPLLEEEE KQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKTSLLLAVYKTVPILELSPPLW TAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLYWKDTRTSGVV FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTL LILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGS KAKAE
Uniprot No.
O75298

Target Background

Function

Recombinant Human Reticulon-2 (RTN2) inhibits amyloid precursor protein processing, likely by blocking BACE1 activity. It enhances trafficking of the glutamate transporter SLC1A1/EAAC1 from the endoplasmic reticulum to the cell surface. Furthermore, it plays a role in the translocation of SLC2A4/GLUT4 from intracellular membranes to the cell membrane, facilitating glucose uptake.

Gene References Into Functions
  1. This study implicates reticulon 2 in axonopathy and demonstrates its involvement in a network of interactions among hereditary spastic paraplegia proteins responsible for endoplasmic reticulum shaping. PMID: 22232211
  2. This publication details the cloning of mouse neuroendocrine-specific protein-like 1 and partial cloning of the human ortholog, along with an investigation into the expression of both mouse and human genes. PMID: 9530622
  3. RTN2B acts as a positive regulator in the delivery of EAAC1 from the ER to the cell surface. PMID: 18096700
  4. sk-NSPl1 is identified as a novel dantrolene receptor that significantly contributes to the membrane translocation of GLUT4 induced by contraction/exercise. The 23-kDa sk-NSPl1 may also regulate whole-body glucose levels. PMID: 19720795
Database Links

HGNC: 10468

OMIM: 603183

KEGG: hsa:6253

STRING: 9606.ENSP00000245923

UniGene: Hs.47517

Involvement In Disease
Spastic paraplegia 12, autosomal dominant (SPG12)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell membrane, sarcolemma, T-tubule; Multi-pass membrane protein. Cytoplasm, myofibril, sarcomere, Z line. Cytoplasm, cytoskeleton.
Tissue Specificity
[Isoform RTN2-C]: Highly expressed in skeletal muscle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.