Recombinant Human Retinoic acid-induced protein 3 (GPRC5A)

Shipped with Ice Packs
In Stock

Description

Overview of GPRC5A

GPRC5A (G protein-coupled receptor class C group 5 member A), also known as retinoic acid-induced protein 3 (RAI3), is a 7-transmembrane receptor encoded by the GPRC5A gene. It belongs to the type 3 GPCR family and plays critical roles in retinoic acid signaling, epithelial cell differentiation, and disease pathogenesis . Recombinant human GPRC5A is produced via bacterial, wheat germ, or cell-free systems for research applications in cancer biology, signaling pathways, and therapeutic development .

Structure and Functional Characteristics

GPRC5A’s structure includes:

  • Seven transmembrane domains (TM1–TM7) forming a characteristic GPCR topology .

  • Extracellular ligand-binding domain interacting with indole derivatives (e.g., tryptamine) and retinoic acid .

  • Intracellular domains involved in G-protein coupling and post-translational modifications (e.g., phosphorylation, glycosylation) .

Key Functions:

  • Retinoic acid signaling: Modulates cellular differentiation and growth .

  • Tumor suppression: Inhibits STAT3, NF-κB, and EGFR pathways in lung cancer .

  • Apoptosis regulation: Promotes intrinsic apoptotic pathways via caspase-3/9 activation in breast cancer .

Clinical Significance and Disease Associations

Cancer TypeGPRC5A RoleKey FindingsSources
Hepatocellular carcinoma (HCC)OncogeneOverexpression correlates with advanced TNM stage, vascular invasion, and poor survival .
Lung cancerTumor suppressorDeletion promotes tumor initiation; inhibits STAT3/NF-κB signaling .
Esophageal squamous cell carcinoma (ESCC)Promotes metastasisDrives lung colonization via trophoblast-like implantation mechanisms .
Breast cancerTumor suppressorDownregulation linked to apoptosis inhibition and PI3K/Akt pathway activation .
Colorectal/pancreatic cancersDual rolesContext-dependent dysregulation linked to progression .

Mechanistic Insights:

  • Post-translational regulation: Phosphorylated at S301/S345 (mitotic regulation) and ubiquitinated at K285/K333/K348/K353 (degradation) .

  • Immune modulation: Associated with neutrophil degranulation and IL signaling in tumor microenvironments .

Recombinant Protein Production and Applications

Recombinant GPRC5A is engineered for functional and structural studies:

ParameterDetailsSources
Expression SystemsE. coli, wheat germ, cell-free
TagsGST, His, N-terminal GST-tagged
Molecular Weight37.0–40.3 kDa
ApplicationsELISA, Western blot, apoptosis/cell cycle assays

Key Features:

  • Partial vs. full-length: Partial constructs (e.g., 269–357 aa) focus on functional domains; full-length includes all 357 aa for structural studies .

  • Storage: Lyophilized or liquid (Tris/PBS buffer with glycerol) at -20°C/-80°C .

Table 1: Recombinant GPRC5A Product Comparison

SourceExpression SystemTagMolecular WeightApplications
CusabioE. coliN-terminal GST37.0 kDaELISA, WB
AbcamWheat germNone40.3 kDaELISA, WB
Creative BioMartCell-freeNone40.3 kDaAntibody production, functional studies

Table 2: GPRC5A Dysregulation in Cancers

CancerExpression TrendPrognostic ImpactMechanism
HCC↑↑Poor survivalPromotes metastasis, vascular invasion
Lung cancerTumor suppressionInhibits STAT3/NF-κB
ESCCMetastasis promotionMimics trophoblast implantation
TNBCApoptosis inhibitionActivates PI3K/Akt

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage state, buffer ingredients, storage temperature and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPRC5A; GPCR5A; RAI3; RAIG1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Phorbol ester induced gene 1; PEIG-1; Retinoic acid-induced gene 1 protein; RAIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN RRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRW DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Uniprot No.

Target Background

Function
GPRC5A, also known as Retinoic acid-induced protein 3 (RAI3), is an orphan receptor. It is potentially involved in modulating epithelial cell differentiation and maintaining homeostasis. This retinoic acid-inducible G protein-coupled receptor (GPCR) suggests a possible interaction between retinoid and G-protein signaling pathways. It functions as a negative modulator of EGFR signaling and might act as a lung tumor suppressor.
Gene References Into Functions
  1. GPRC5a was upregulated in pancreatic cancer (PaCa) leading to enhanced drug resistance in PaCa cells. PMID: 29949874
  2. Downregulation of GPRC5A during lung tumorigenesis enhances transcriptional stimulation through an active translational status. PMID: 27273304
  3. Research findings reveal a novel role for GPRC5A in regulating ITGB1-mediated cell adhesion and its downstream signaling, suggesting a potential role for GPRC5A in human epithelial cancers. PMID: 27715394
  4. miR-204 inhibits cell proliferation in gastric cancer by targeting CKS1B, CXCL1 and GPRC5A. PMID: 29283424
  5. p53 overexpression and GPRC5A induction significantly inhibited tumor cell viability and induced apoptosis. PMID: 28849235
  6. GPRC5A is a potential oncogene in pancreatic ductal adenocarcinoma cells that is upregulated by gemcitabine with the assistance of HuR. PMID: 27415424
  7. These findings suggest that RAI3 plays a significant role in adipogenesis of hASCs and may have potential future applications. PMID: 28870805
  8. The study highlights genomic alterations representing early events in the development of Kras mutant LUAD following Gprc5a loss and tobacco carcinogen exposure. PMID: 28653505
  9. Suppression of GPRC5a results in decreased cell growth, proliferation and migration in pancreatic cancer cell lines via a STAT3 modulated pathway, independent of ERK activation. PMID: 28114355
  10. Our findings implicate GPRC5A as a tumor suppressor in breast cancer cells, and GPRC5A exerts its tumor-suppressive function by inhibiting EGFR and its downstream pathway. PMID: 27599526
  11. Elevated levels of GPRC5A play significant roles in gastric cancer progression. PMID: 26227221
  12. Results demonstrate how GPRC5A deficiency leads to dysregulated EGFR and STAT3 signaling and lung tumorigenesis. PMID: 25744720
  13. EGFR interacts with GPRC5A and phosphorylates it in two conserved double-tyrosine motifs, Y317/Y320 and Y347/ Y350, at the C-terminal tail of GPRC5A. PMID: 25311788
  14. The interaction of miR-103a-3p with each of the two 5' UTR targets reduces the expression levels of both GPRC5A mRNA and GPRC5A protein in one normal epithelial and two pancreatic cancer cell lines. PMID: 24984703
  15. RAI3 may contribute to the malignant progression of hepatocellular carcinoma. PMID: 23632812
  16. Data indicate that in mammary tumors, the mRNA expression of GPRC5A significantly correlated with that of BRCA1. PMID: 24470238
  17. Decreased GPRC5A expression is associated with non-small cell lung cancers and lung inflammation. PMID: 23154545
  18. Loss of GPRC5A is associated with lung adenocarcinomas. PMID: 20563252
  19. RAI3 is a cell growth-promoting gene and a novel P53 transcriptional target. PMID: 15659406
  20. This evidence explains one of the mechanisms of GPRC5A-regulated cell growth in some cancer cell lines. PMID: 17055459
  21. Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property. PMID: 18000218
  22. Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported. PMID: 19279407
  23. Analysis of RAI3 expression in normal and cancerous human breast tissue at both the mRNA and protein levels. PMID: 19552806

Show More

Hide All

Database Links

HGNC: 9836

OMIM: 604138

KEGG: hsa:9052

STRING: 9606.ENSP00000014914

UniGene: Hs.631733

Protein Families
G-protein coupled receptor 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to mod

Q&A

What is GPRC5A and what cellular pathways is it involved in?

GPRC5A is a member of the 'Retinoic Acid-Inducible G-protein-coupled receptors' (RAIG) group, which consists of four orphan receptors: GPRC5A, GPRC5B, GPRC5C, and GPRC5D. As the name suggests, its expression is induced by retinoic acid. The protein is involved in several cellular pathways, particularly those related to tumor development and progression . Recent research using Gene Set Enrichment Analysis (GSEA) has revealed that GPRC5A is primarily associated with neutrophil degranulation, signaling by interleukins, GPCR ligand binding, and the RHO GTPase cycle . These pathways suggest GPRC5A plays roles in both immune regulation and signal transduction across various cellular contexts.

How is the GPRC5A gene structurally organized and regulated at the transcriptional level?

The GPRC5A gene contains a novel retinoic acid response element (RARE) at its proximal 5′ upstream region. In the absence of retinoic acid, retinoic acid receptors bind to this RARE as RAR/RXR heterodimers, recruiting co-repressor proteins and repressing GPRC5A gene transcription. When agonist ligands bind to RAR/RXRs, co-repressors dissociate and co-activator proteins are recruited, promoting GPRC5A gene transcription .

Additionally, the GPRC5A gene locus contains p53 consensus DNA binding sequences in the promoter region. Wild-type p53 has been shown to repress GPRC5A expression, while p53 mutations lead to increased GPRC5A levels in cancer cells. The promoter region also contains a cAMP-responsive element (CRE), allowing GPRC5A expression to be induced by cAMP signaling. Interestingly, cAMP and retinoic acid might synergistically regulate GPRC5A expression .

What is the expression pattern of GPRC5A across different cancer types?

GPRC5A shows variable expression patterns across different cancer types. According to comprehensive analyses of 33 tumor datasets from TCGA and GTEx databases, GPRC5A is differentially expressed between tumor and normal tissues in multiple cancer types .

The following table summarizes GPRC5A dysregulation in various diseases:

DiseaseExpression Level (Cancer vs. Normal)Methods Used
Oral Squamous Cell CarcinomaElevatedIHC
Non-Small Cell Lung CarcinomaAlteredMicroarray; qRT-PCR
Chronic Obstructive Pulmonary DiseaseAlteredMicroarray; qRT-PCR
Breast CarcinomaAlteredNGS; RT-PCR
Hepatocellular CarcinomaAlteredMicroarray; qRT-PCR; WB; IHC
Colorectal AdenocarcinomaAlteredLC-MS/MS; IHC
Gastric CarcinomaAlteredMicroarray; qRT-PCR
Intrahepatic CholangiocarcinomaAlteredMicroarray; qRT-PCR
Pancreatic Ductal AdenocarcinomaAlteredMicroarray

This expression pattern heterogeneity suggests context-dependent roles for GPRC5A across different malignancies .

How does GPRC5A function as both a tumor suppressor and an oncogene?

GPRC5A exhibits a dual-behavior pattern, functioning as either a tumor suppressor or an oncogene depending on the cancer type and cellular context. This dual behavior makes GPRC5A particularly interesting in cancer research .

As a tumor suppressor:

  • In lung cancer, loss of GPRC5A has been associated with increased tumor development

  • Its expression can inhibit cell proliferation and promote apoptosis in certain cellular contexts

As an oncogene:

  • In breast cancer with p53 mutations, GPRC5A is upregulated and promotes tumor growth

  • In colorectal adenocarcinoma, higher expression is associated with disease recurrence

  • In pancreatic cancer, it appears to promote cancer cell survival and proliferation

This context-dependent function likely depends on:

  • The specific signaling environment in different tissues

  • Genetic background (particularly p53 status)

  • Interaction with tissue-specific transcription factors

  • Differential regulation by microRNAs across tissue types

What is the prognostic value of GPRC5A expression in cancer?

GPRC5A has demonstrated significant prognostic value across several cancer types. In a comprehensive meta-analysis, GPRC5A expression was evaluated for its relationship with cancer prognosis across multiple studies .

In colorectal cancer specifically, RAI3 (GPRC5A) overexpression has been identified as a potential prognostic marker. A study analyzing 367 colorectal cancer tissue samples found that a subset of patients (7.4%) displayed very strong cytoplasmic expression of RAI3, which was significantly associated with disease recurrence in Dukes' A-C (stage I-III) patients with a hazard ratio of 3.076 (95% CI=1.738-5.445; p<0.001) compared to low or negative expression .

This association retained univariate significance in Dukes' B/stage II patients only (HR=3.494, 95% CI=1.197-10.20; p<0.022). Critically, the prognostic capacity of RAI3 was maintained in the stage I-III cohort following multivariate modeling (HR=2.11, 95% CI 1.109-4.017, p=0.023) .

More recent research has expanded the prognostic evaluation of GPRC5A to multiple cancer types, including adrenocortical carcinoma (ACC), kidney renal clear cell carcinoma (KIRC), low-grade glioma (LGG), and pancreatic adenocarcinoma (PAAD), where its expression was found to be prognostically significant .

What post-transcriptional mechanisms regulate GPRC5A expression?

MicroRNAs (miRNAs) play a significant role in the post-transcriptional regulation of GPRC5A. While this area is still being explored, some important findings include:

  • miR-103a-3p has been shown to target the 5′UTR of GPRC5A mRNA in pancreatic cells, which is particularly noteworthy as miRNA targeting of 5′UTRs leading to mRNA down-regulation is relatively rare

  • Overexpression of miR-103a-3p reduces both GPRC5A mRNA and protein in cells

  • Computational predictions using the rna22 algorithm suggest many other putative miRNA target sites throughout the GPRC5A mRNA

The table below shows the number of distinct miRBase miRNAs and target sites that rna22 predicts target GPRC5A (P-val ≤ 0.05):

RegionNumber of targeting miRNAs (predicted)Number of Targeting sites (predicted)
5′UTR34398
CDS595223
3′UTR1170922

RNA binding proteins (RBPs) and long non-coding RNAs (lncRNAs) are also suspected to post-transcriptionally regulate GPRC5A, though concrete data is currently limited .

How does the p53 pathway influence GPRC5A expression?

The relationship between p53 and GPRC5A is particularly significant in cancer research. The GPRC5A gene locus contains p53 consensus DNA binding sequences in the promoter region. Studies have shown that:

  • Overexpression of wild-type p53 represses GPRC5A expression in the 2774qw1 human ovarian tumor cell line

  • Microarray and quantitative RT-PCR analyses in multiple breast cancer cell lines demonstrate that GPRC5A mRNA is up-regulated in p53-mutated cell lines

  • Cell lines with mutant p53 (MDA-MB-468, BT-20, BT-549, and SK-BR-3) show higher GPRC5A expression compared to those with wild-type p53 (T47D, MCF7, ZR-75-1, and BT474)

This regulatory relationship suggests that GPRC5A dysregulation in cancers may be partly due to the common occurrence of p53 mutations, which release the suppressive effect of wild-type p53 on GPRC5A expression .

What are the most effective methods for detecting and measuring GPRC5A expression in tissue samples?

Researchers have employed several complementary techniques to detect and quantify GPRC5A expression:

  • Immunohistochemistry (IHC): This technique has been widely used to evaluate GPRC5A protein expression in various cancer tissues. IHC allows visualization of protein expression patterns within the cellular context, revealing that GPRC5A can show diffuse cytoplasmic expression in cancer cells. In colorectal cancer, 76% of cases displayed diffuse cytoplasmic expression, with 7.4% showing very strong expression .

  • Microarray analysis: This approach has been employed to analyze GPRC5A mRNA expression across multiple tumor types and can be used for large-scale screening .

  • Quantitative RT-PCR (qRT-PCR): This method provides more precise quantification of GPRC5A mRNA levels and has been used to validate microarray findings in several studies .

  • Next-Generation Sequencing (NGS): This technique allows for comprehensive analysis of gene expression and has been applied to study GPRC5A in breast carcinoma .

  • Mass spectrometry-based proteomics: Label-free mass spectrometric (MS) quantitation has been successfully used to identify GPRC5A/RAI3 as a plasma membrane protein overexpressed in colorectal cancer .

  • Western blotting (WB): This technique has been utilized for protein-level confirmation of GPRC5A expression in hepatocellular carcinoma .

For optimal results, researchers should consider using multiple complementary techniques, as each provides different insights into GPRC5A expression.

How can researchers effectively study GPRC5A's interactions with the immune microenvironment?

The interaction between GPRC5A and the tumor immune microenvironment has emerged as an important area of research. To effectively study these interactions, researchers can employ the following approaches:

  • Correlation analysis between GPRC5A expression and immune cell infiltration: Using databases like GEPIA2, researchers can analyze the relationship between GPRC5A expression and various immune cells, including B cells, macrophages, and neutrophils. Heatmaps can be generated to visualize these correlations across multiple cancer types .

  • Gene Set Enrichment Analysis (GSEA): This method can identify biological pathways associated with GPRC5A expression, particularly immune-related pathways. Recent GSEA has revealed that GPRC5A is primarily associated with neutrophil degranulation and signaling by interleukins .

  • Immunohistochemical co-staining: This technique allows for simultaneous visualization of GPRC5A expression and immune cell markers in tissue samples, providing spatial information about their relationship.

  • Single-cell RNA sequencing: This advanced approach can reveal cell-type-specific expression patterns and interactions between GPRC5A-expressing cells and immune cells.

  • In vitro co-culture systems: Researchers can establish co-cultures of GPRC5A-expressing cancer cells with various immune cell populations to study their functional interactions.

  • Cytokine profiling: Measuring cytokine production in the presence of varying GPRC5A expression levels can provide insights into how GPRC5A influences the immune microenvironment.

These methods collectively can provide a comprehensive understanding of how GPRC5A modulates the tumor immune microenvironment across different cancer types.

What are the key challenges in developing GPRC5A-targeted therapies?

Developing therapies targeting GPRC5A presents several significant challenges:

  • Dual functional behavior: GPRC5A can function as either a tumor suppressor or an oncogene depending on the cancer type and cellular context. This dual nature necessitates careful consideration of cancer-specific targeting strategies to avoid unintended consequences .

  • Tissue-specific expression patterns: GPRC5A expression varies significantly across different tissues and cancer types, requiring tissue-specific targeting approaches .

  • Orphan receptor status: As an orphan receptor, GPRC5A lacks identified endogenous ligands, complicating the development of compounds that could modulate its activity. Identifying natural or synthetic ligands remains a critical research gap.

  • Complex regulatory mechanisms: GPRC5A is regulated at multiple levels (transcriptional, post-transcriptional) by various factors including retinoic acid, p53, cAMP, and miRNAs. This complex regulation makes it challenging to predict the effects of therapeutic interventions .

  • Interaction with the immune microenvironment: GPRC5A's involvement in modulating the immune microenvironment adds another layer of complexity to therapeutic development, as interventions might have indirect effects on immune responses .

  • Limited understanding of downstream signaling: While GPRC5A is involved in GPCR ligand binding and the RHO GTPase cycle, the complete picture of its downstream signaling networks remains incomplete, hampering rational drug design .

Addressing these challenges requires integrative approaches combining structural biology, drug discovery, cancer biology, and immunology to develop effective GPRC5A-targeted therapeutic strategies.

How can GPRC5A expression be integrated with other biomarkers for improved cancer prognosis?

Integrating GPRC5A with other biomarkers offers significant potential for enhancing cancer prognosis prediction:

  • Multivariate prognostic models: Researchers have demonstrated that GPRC5A retains prognostic significance in multivariate models. For colorectal cancer, GPRC5A/RAI3 maintained prognostic capacity in stage I-III patients following multivariate modeling (HR=2.11, 95% CI 1.109-4.017, p=0.023), suggesting it can complement existing prognostic factors .

  • Nomogram development: Developing nomogram models that incorporate GPRC5A expression alongside clinical parameters can improve survival probability predictions. Such models have been explored for various cancer types where GPRC5A has prognostic value .

  • Immune signature integration: Given GPRC5A's correlation with immune cell infiltration, combining GPRC5A expression with immune signature markers could provide more comprehensive prognostic information, particularly regarding immunotherapy response .

  • Molecular subtyping: Integrating GPRC5A expression into molecular subtyping schemes could help refine cancer classification and improve treatment stratification.

  • Multi-omics approaches: Combining GPRC5A expression data with genomic, transcriptomic, proteomic, and metabolomic profiles could yield more robust prognostic signatures across different cancer types.

  • AI-based prediction models: Developing machine learning algorithms that incorporate GPRC5A alongside other biomarkers could enhance prognostic accuracy and identify patients most likely to benefit from specific therapeutic interventions.

Future research should focus on validating these integrated approaches in large, prospective cohorts across multiple cancer types to establish their clinical utility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.