Recombinant Human Retinol dehydrogenase 16 (RDH16)

Shipped with Ice Packs
In Stock

Description

Overview of RDH16

RDH16 (Retinol Dehydrogenase 16), also known as SDR9C8 or RODH-4, belongs to the short-chain dehydrogenase/reductase (SDR) superfamily . It catalyzes the oxidation of retinol isomers (all-trans, 9-cis, 11-cis, and 13-cis) into retinaldehydes, a key step in retinoic acid synthesis . Additionally, it modulates steroid metabolism by oxidizing 3α-hydroxysteroids, including androstanediol and androsterone .

Role in Hepatocellular Carcinoma (HCC)

  • Downregulation in HCC: RDH16 expression is reduced in ~90% of HCC cases, correlating with poor prognosis, larger tumor size, and metastasis .

  • Mechanism: Methylation of the RDH16 promoter silences its expression, reducing retinoic acid levels and promoting fatty acid synthesis in cancer cells .

  • Tumor-Suppressing Effects: Ectopic expression of RDH16 inhibits HCC cell proliferation, clonogenicity, and motility .

Research Applications

Recombinant RDH16 is utilized in:

  • Antibody Development: Polyclonal antibodies (e.g., ab224163) target recombinant fragments (amino acids 150–300) for immunohistochemistry (IHC) and Western blot (WB) .

  • Functional Studies: Used to elucidate roles in retinoic acid signaling and cancer pathways .

Therapeutic Targets

  • Retinoic Acid Modulation: RDH16 overexpression restores retinoic acid levels, suppressing HCC growth .

  • Fatty Acid Synthesis Inhibition: Blocks de novo lipogenesis, a metabolic vulnerability in cancer cells .

Challenges and Future Directions

  • Mechanistic Gaps: The exact regulatory mechanisms of RDH16 in non-hepatic tissues (e.g., epidermis) remain unclear .

  • Therapeutic Development: Targeting RDH16 methylation or enhancing its activity could offer novel HCC treatments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RDH16; RODH4; SDR9C8; Retinol dehydrogenase 16; Human epidermal retinol dehydrogenase; hRDH-E; Microsomal NAD(+-dependent retinol dehydrogenase 4; RoDH-4; Short chain dehydrogenase/reductase family 9C member 8; Sterol/retinol dehydrogenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RDH16
Target Protein Sequence
MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL
Uniprot No.

Target Background

Function
Recombinant Human Retinol Dehydrogenase 16 (RDH16) is an oxidoreductase exhibiting a preference for NAD+. It catalyzes the oxidation of all-trans-retinol, 9-cis-retinol, 11-cis-retinol, and 13-cis-retinol to their corresponding aldehydes. RDH16 demonstrates higher activity towards CRBP-bound retinol compared to free retinol. Additionally, it oxidizes 3-alpha-hydroxysteroids, such as androstanediol and androsterone, to dihydrotestosterone and androstanedione, respectively. The enzyme also possesses the capacity to catalyze the reverse reaction.
Gene References Into Functions
  1. RDH16 functions as a stemness suppressor, partially mitigating the NSPc1-induced increase in neurosphere formation observed in stem cell-like glioma cells. PMID: 28394339
  2. Studies on endometrial cancers have revealed a significant reduction in hRoDH-4 (human RDH16) immunoreactivity. PMID: 11967490
  3. Functional characterization of RoDH-4 (RDH16) has identified it as the enzyme responsible for accessing bound retinol to facilitate retinoic acid production. PMID: 12534290
Database Links

HGNC: 29674

KEGG: hsa:8608

STRING: 9606.ENSP00000381206

UniGene: Hs.134958

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Microsome membrane. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in adult liver (at protein level). Detected in endometrium, liver and foreskin. Detected in the spineous layers of adult skin, and at lower levels in basal and granular skin layers. Detected in fetal liver and lung.

Q&A

What is the molecular identity of human RDH16?

RDH16 (Retinol Dehydrogenase 16) is a protein-coding gene belonging to the short chain dehydrogenase/reductase (SDR) superfamily of proteins, specifically classified as SDR9C8. The protein functions as an oxidoreductase with preference for NAD as a cofactor. RDH16 is identified by several database entries, including HGNC: 29674, NCBI Gene: 8608, Ensembl: ENSG00000139547, OMIM: 620043, and UniProtKB/Swiss-Prot: O75452 . The gene has several alternative names including RODH-4, Short Chain Dehydrogenase/Reductase Family 9C Member 8, and Human Epidermal Retinol Dehydrogenase . Understanding the molecular identity is essential for designing gene constructs for recombinant protein expression.

What are the primary enzymatic activities of RDH16?

RDH16 demonstrates multiple oxidoreductase activities:

  • NAD-retinol dehydrogenase activity: Oxidizes all-trans-retinol, 9-cis-retinol, 11-cis-retinol, and 13-cis-retinol to their corresponding aldehydes .

  • Steroid metabolism: Exhibits androstan-3-alpha,17-beta-diol dehydrogenase activity and androsterone dehydrogenase activity .

  • Substrate preferences: Shows higher activity toward CRBP-bound retinol compared to free retinol .

  • Bidirectional activity: Can catalyze both oxidation (converting retinol to retinaldehyde and androstanediol to dihydrotestosterone) and reduction reactions under specific conditions .

These diverse activities indicate that experimental design should account for potential multiple substrate specificities when studying recombinant RDH16.

What cellular localization patterns does RDH16 exhibit?

RDH16 is primarily located in intracellular membrane-bounded organelles . The protein has been characterized as microsomal, consistent with its designation as "microsomal NAD(+)-dependent retinol dehydrogenase 4" in some nomenclature systems . This localization pattern is important for designing immunofluorescence or subcellular fractionation experiments when studying recombinant RDH16 expression in cellular models. Researchers should incorporate appropriate organelle markers when conducting colocalization studies.

What expression systems are optimal for producing functional recombinant human RDH16?

Based on published research methodologies, several expression systems have been used for RDH16 production with varying degrees of success:

  • HEK293 cells: Suitable for expressing native human RDH16, though expression levels may be moderate .

  • HepG2 cells: Have been successfully used for expressing RDH16, particularly relevant for liver-related research .

  • Sf9 insect cells: Beneficial for producing stable protein, as demonstrated with the related protein RDHE2S .

When designing expression constructs, researchers should consider incorporating appropriate tags for purification and detection while ensuring these modifications don't interfere with the protein's membrane association or enzymatic function. The choice of expression system should align with downstream applications, with mammalian systems preferred when studying post-translational modifications or interaction with mammalian cellular components.

What are the validated methods for measuring RDH16 enzymatic activity?

RDH16 activity can be assessed through several complementary approaches:

  • Spectrophotometric assays: Monitoring NAD+ reduction to NADH at 340 nm when RDH16 oxidizes retinol substrates .

  • HPLC analysis: Quantifying the conversion of retinol to retinaldehyde or steroid substrate conversions .

  • Mass spectrometry: Providing detailed analysis of substrate-product relationships and identifying potentially novel substrates.

  • Cell-based assays: Measuring changes in retinoid or steroid metabolism in cells with manipulated RDH16 expression .

When designing activity assays, researchers should account for RDH16's preference for NAD+ as a cofactor and consider that activity may differ between free retinol and CRBP-bound retinol substrates .

How can RDH16 expression be effectively modulated in experimental models?

Several approaches have proven effective for modulating RDH16 expression:

  • Overexpression systems: Transfection of expression vectors containing the RDH16 coding sequence has been successfully used to achieve ectopic expression, particularly in HCC cell lines .

  • RNA interference: siRNA or shRNA approaches can effectively knockdown endogenous RDH16.

  • CRISPR-Cas9 genome editing: For creating knockout models or introducing specific mutations.

  • Pharmacological modulation: 17β-estradiol has been shown to decrease RDH16 expression, which could be utilized as an experimental tool .

When implementing these approaches, researchers should verify expression changes at both mRNA (qRT-PCR) and protein (Western blot) levels, as post-transcriptional regulation may occur.

What evidence supports RDH16's role as a tumor suppressor gene?

Multiple lines of evidence establish RDH16 as a potential tumor suppressor gene, particularly in hepatocellular carcinoma:

These findings collectively suggest that RDH16 functions as a bona fide tumor suppressor gene, with potential implications for cancer diagnosis and therapy.

What mechanisms regulate RDH16 expression in cancer cells?

Several regulatory mechanisms appear to control RDH16 expression in cancer contexts:

  • Epigenetic regulation: Higher density of DNA methylation has been identified in HCC samples compared to non-tumor tissues, suggesting epigenetic silencing as a key mechanism of RDH16 downregulation .

  • Hormonal regulation: 17β-estradiol has been shown to decrease RDH16 expression, indicating potential hormonal control mechanisms .

  • Complex regulatory interactions: When 17β-estradiol is co-treated with TGFB1 protein, an increase in RDH16 mRNA expression occurs, suggesting context-dependent regulation .

Understanding these regulatory mechanisms provides potential avenues for therapeutic intervention aimed at restoring RDH16 expression in cancer contexts.

How does RDH16 influence retinoic acid signaling in cancer cells?

RDH16's influence on retinoic acid signaling in cancer appears multifaceted:

  • Metabolic contribution: RDH16 oxidizes retinol to retinaldehyde, which is subsequently converted to retinoic acid, the active signaling molecule .

  • Signaling amplification: Increased RDH16 expression leads to elevated retinoic acid levels in HCC cells .

  • Downstream effects: By increasing retinoic acid levels, RDH16 may activate retinoic acid receptors (RARs) and retinoid X receptors (RXRs), thereby influencing gene expression programs related to differentiation and cell growth inhibition.

  • Metabolic reprogramming: RDH16-mediated increases in retinoic acid correlate with blocked de novo fatty acid synthesis in HCC cells, suggesting metabolic consequences of altered retinoid signaling .

These findings position RDH16 as an important upstream regulator of retinoic acid signaling, with potential implications for differentiation therapy approaches in cancer.

How does RDH16 integrate into the broader retinoid metabolism network?

RDH16 functions as a key component in the retinoid metabolism network:

  • Position in retinoid metabolism: RDH16 catalyzes the first oxidative step in retinoic acid biosynthesis by converting retinol to retinaldehyde .

  • Relationship to other RDHs: While RDH10 (SDR16C4) is considered the major enzyme responsible for retinol oxidation during embryogenesis, RDH16 represents an additional contributor to this process in specific tissues and contexts .

  • Substrate specificity: Unlike some other RDHs, RDH16 can oxidize multiple retinol isomers including all-trans-retinol, 9-cis-retinol, 11-cis-retinol, and 13-cis-retinol .

  • Interaction with binding proteins: RDH16 shows higher activity toward CRBP-bound retinol than free retinol, suggesting functional interaction with cellular retinoid binding proteins .

This integrated function highlights why studying RDH16 requires consideration of the broader retinoid homeostasis network rather than isolated enzymatic activity.

What is the relationship between RDH16 and steroid metabolism?

RDH16 demonstrates significant involvement in steroid metabolism through several activities:

  • Androgen metabolism: RDH16 oxidizes androstanediol to dihydrotestosterone and androsterone to androstanedione .

  • Bidirectional activity: Can catalyze both oxidative and reductive reactions in steroid metabolism, potentially functioning as a regulator of local androgen concentrations .

  • Hormonal regulation: RDH16 expression is itself regulated by hormones such as 17β-estradiol .

These dual roles in both retinoid and steroid metabolism position RDH16 as a potential integrator of these two important signaling pathways, with implications for tissues where both pathways are active.

What protein-protein interactions influence RDH16 function?

While the search results don't explicitly detail all protein-protein interactions, several potential interactions can be inferred:

  • Cellular retinol binding protein (CRBP): RDH16 shows higher activity toward CRBP-bound retinol than free retinol, suggesting functional interaction .

  • Membrane-associated proteins: Given RDH16's localization to intracellular membrane-bounded organelles, interactions with membrane components are likely important for proper localization and function .

  • Potential hormone receptor interactions: The regulation of RDH16 by 17β-estradiol and its enhancement by TGFB1 suggests potential indirect interactions with hormone receptors and their signaling pathways .

Further proteomic and interaction studies would be valuable to fully characterize the RDH16 interactome.

What is the potential of RDH16 as a prognostic biomarker in cancer?

Evidence supports RDH16's potential as a prognostic biomarker, particularly in hepatocellular carcinoma:

These associations suggest that RDH16 expression analysis could provide valuable prognostic information, potentially guiding treatment decisions in HCC patients.

How might targeting RDH16 or its pathways offer therapeutic opportunities?

Several therapeutic strategies centered on RDH16 show promise:

  • Epigenetic therapy: Given the evidence for epigenetic silencing of RDH16 in HCC, epigenetic modifiers (such as DNA methyltransferase inhibitors) might restore RDH16 expression .

  • Retinoid therapy enhancement: RDH16's role in retinoic acid production suggests that strategies to increase RDH16 expression or activity might enhance the efficacy of retinoid-based differentiation therapies.

  • Metabolic targeting: RDH16's influence on blocking de novo fatty acid synthesis in HCC cells suggests potential synergies with metabolic therapies targeting cancer cell metabolism .

  • Synthetic lethality approaches: Identifying dependencies created by RDH16 loss in cancer cells could reveal synthetic lethal therapeutic targets.

Research exploring these approaches could yield novel therapeutic strategies for cancers with altered RDH16 expression.

What methodological considerations are important when evaluating RDH16 in clinical samples?

When studying RDH16 in clinical contexts, researchers should consider:

  • Expression analysis methods: Both mRNA (qRT-PCR) and protein (immunohistochemistry, Western blot) analyses provide complementary information about RDH16 status .

  • Methylation analysis: Assessing RDH16 promoter methylation can provide insights into the mechanism of expression loss .

  • Tissue heterogeneity: Comparing matched tumor and non-tumor tissues is essential for accurate assessment of RDH16 alterations .

  • Functional validation: Where possible, functional studies using patient-derived materials can confirm the biological significance of RDH16 alterations.

  • Correlation with clinical parameters: Comprehensive clinical annotation is crucial for establishing RDH16's prognostic value .

These methodological considerations ensure robust and clinically relevant assessment of RDH16 status in patient samples.

What are the critical knowledge gaps in RDH16 research?

Several important knowledge gaps remain in our understanding of RDH16:

  • Tissue-specific functions: While RDH16's role in liver cancer has been investigated, its functions in other tissues remain largely unexplored.

  • Regulatory mechanisms: Beyond methylation and hormonal regulation, other mechanisms controlling RDH16 expression and activity require investigation.

  • Complete substrate profile: The full range of physiological substrates for RDH16, particularly in non-hepatic tissues, remains to be fully characterized.

  • Structure-function relationships: Detailed structural studies would enhance understanding of RDH16's catalytic mechanism and substrate specificity.

  • Interactome: A comprehensive characterization of RDH16's protein-protein interactions would provide insights into its functional integration within cellular networks.

Addressing these knowledge gaps represents important opportunities for advancing RDH16 research.

What novel experimental approaches might advance RDH16 research?

Emerging technologies offer new avenues for investigating RDH16:

  • Single-cell analyses: Examining RDH16 expression and function at single-cell resolution could reveal cell type-specific roles and heterogeneity.

  • CRISPR screens: Genome-wide CRISPR screens in RDH16-manipulated cells could identify synthetic interactions and functional dependencies.

  • Metabolomics approaches: Comprehensive metabolomic profiling in models with altered RDH16 expression would reveal the full metabolic impact of RDH16 activity.

  • Patient-derived organoids: Using organoid models to study RDH16 function in a more physiologically relevant context.

  • In vivo gene editing: Generating tissue-specific RDH16 knockout or overexpression models to investigate its function in complex physiological settings.

These approaches would provide new insights into RDH16 biology and potential therapeutic applications.

How might RDH16 research intersect with emerging areas in cancer metabolism?

RDH16 research shows promising connections to cutting-edge areas in cancer metabolism:

  • Metabolic reprogramming: RDH16's role in blocking de novo fatty acid synthesis in HCC cells connects to the broader field of cancer metabolic reprogramming .

  • Tumor microenvironment: The influence of RDH16 on retinoic acid production may affect tumor-immune interactions, given retinoic acid's known immunomodulatory functions.

  • Differentiation therapy: RDH16's position in retinoid metabolism links to differentiation therapy approaches that aim to restore normal differentiation programs in cancer cells.

  • Precision oncology: RDH16 expression patterns could potentially serve as biomarkers for stratifying patients for specific therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.