Recombinant Human Retinol dehydrogenase 8 (RDH8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RDH8; PRRDH; SDR28C2; Retinol dehydrogenase 8; Photoreceptor outer segment all-trans retinol dehydrogenase; Short chain dehydrogenase/reductase family 28C member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RDH8
Target Protein Sequence
MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTL TVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVR LVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFI SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQ AIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLS CGCLPTRVRPR
Uniprot No.

Target Background

Function
Recombinant Human Retinol dehydrogenase 8 (RDH8) is a retinol dehydrogenase that exhibits a strong preference for NADP+. It catalyzes the conversion of all-trans-retinal to all-trans-retinol. RDH8 is believed to play a role in visual pigment regeneration, particularly under conditions of high light intensity.
Gene References Into Functions
  1. Progression of retinal degeneration in Rdh8-deficient Abca4-deficient mice is affected by differential vulnerability of rods and cones to light. PMID: 22220722
  2. Family- and population-based studies suggest that the RDH8 gene is unlikely to be associated with high myopia in Chinese populations. PMID: 21043051
  3. prRDH, an enzyme catalyzing the reduction of all-trans-retinal in rod outer segments, is most active at higher light intensities and prolonged illumination; however, it is not considered an essential enzyme in the retinoid cycle. PMID: 15755727
Database Links

HGNC: 14423

OMIM: 608575

KEGG: hsa:50700

STRING: 9606.ENSP00000171214

UniGene: Hs.675522

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in photoreceptor outer segments in the retina (at protein level).

Q&A

What is RDH8 and what is its primary function in the visual cycle?

RDH8 (Retinol Dehydrogenase 8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH. It belongs to the short-chain dehydrogenase/reductase (SDR) family and is primarily localized in the outer segments of photoreceptor cells, hence its alternative name "photoreceptor retinol dehydrogenase." RDH8 plays a critical role in the rhodopsin regeneration pathway by reducing all-trans-retinal (the product of bleached and hydrolyzed rhodopsin), which represents a rate-limiting step in the visual cycle .

How does RDH8 function differ from other retinol dehydrogenases like RDH12?

While both RDH8 and RDH12 contribute to all-trans-retinal clearance, they have distinct localizations and functional characteristics:

  • RDH8: Primarily functions in the outer segments of photoreceptors

  • RDH12: Functions mainly in the inner segments of photoreceptors

How does substrate specificity of RDH8 compare with related dehydrogenases?

Unlike some related enzymes, RDH8 appears to be relatively specific for all-trans-retinal. For comparison:

  • RDH12 recognizes both retinoids and lipid peroxidation products (C9 aldehydes) as substrates, with the highest catalytic efficiency for all-trans-retinal (kcat/Km ~900 min−1 μM−1), followed by 11-cis-retinal (450 min−1 mM−1) and 9-cis-retinal (100 min−1 mM−1) .

  • RDH10 exhibits a lower apparent Km value for all-trans-retinol (~0.035 μM) than other NAD+-dependent retinoid oxidoreductases, and recognizes cis-retinols as well as all-trans-retinol .

  • RDH16 shows only marginal activity with all-trans-retinol compared to RDH10 .

What are reliable methods for measuring RDH8 activity in isolated photoreceptors?

For measuring RDH8 activity in isolated photoreceptors, fluorescence-based imaging provides high sensitivity:

Methodology from published research:

  • Generate all-trans-retinal endogenously by bleaching rhodopsin or supply it exogenously with bovine serum albumin as carrier

  • Measure formation of all-trans-retinol by imaging its fluorescence (Ex: 360 nm; Em: >420 nm)

  • Differentiate between retinal and retinol contribution to the fluorescence signal by using excitation light of different wavelengths (340, 360, and 380 nm)

This approach allows direct visualization of RDH8 activity within the cellular context of photoreceptors.

What approaches can be used for SNP discovery and genotyping in the RDH8 gene?

Denaturing high-performance liquid chromatography (DHPLC) has proven effective for both SNP discovery and genotyping in the RDH8 gene:

Procedure:

  • Create DNA pools (e.g., four pools each consisting of DNA from five individuals)

  • Screen for SNPs using DHPLC

  • Genotype identified SNPs in the target population

  • Analyze linkage disequilibrium (LD) and haplotype patterns using software such as ASSOCIATE and EH programs

This approach has successfully identified both common and novel SNPs in the RDH8 gene, with different LD patterns observed in the 5' and 3' regions of the gene.

What linkage disequilibrium patterns exist around the RDH8 gene?

Studies on the RDH8 gene have revealed distinct linkage disequilibrium (LD) patterns that are important for association studies:

  • Four SNPs in the 3' region exhibit significant LD and form a haplotype block

  • Three common SNPs in the 5' region do not exhibit useful LD

  • For association studies involving RDH8, it is recommended to use one SNP from the 3' region and two to three SNPs from the 5' region

What is the evidence for RDH8 involvement in retinal diseases?

A significant breakthrough came with the identification of a biallelic mutation in the RDH8 gene associated with Stargardt macular dystrophy:

  • A splicing variant (c.262+1G>A) in RDH8 was identified in a consanguineous Italian family

  • The variant was classified as pathogenic according to ACMG guidelines

  • This represents the first reported family with a biallelic deleterious mutation in RDH8 causing human disease

  • The disease phenotype is consistent with expected outcomes based on previous studies in murine models

This finding establishes RDH8 as a causative gene for inherited retinal disorders, particularly Stargardt macular dystrophy.

How does RDH8 interact with cellular retinol binding proteins?

  • Studies with RDH12 show that it utilizes the unbound forms of all-trans and 11-cis retinoids

  • Cellular retinol-binding protein (CRBPI), which binds all-trans-retinol with higher affinity than all-trans-retinaldehyde, restricts the oxidation but has little effect on reduction

  • CRALBP inhibits the reduction of 11-cis-retinal more strongly than the oxidation of 11-cis-retinol

These findings suggest that RDH8 likely also utilizes unbound retinoids rather than those complexed with binding proteins.

What is the functional relationship between RDH8, RDH12, and ABCA4?

The functional relationship between these proteins has been elucidated through knockout mouse models:

  • Single knockouts: Show modest phenotypes

  • Double knockouts (Rdh8−/−Abca4−/−): Display slowly progressive, severe retinal degeneration under room light conditions

  • Triple knockouts (Rdh8−/−Rdh12−/−Abca4−/−):

    • Exhibit accelerated severe retinal degeneration

    • Show intense light-induced acute retinal degeneration detectable by SD-OCT

    • Accumulate higher levels of A2E (a toxic byproduct) in the RPE

    • Demonstrate significantly delayed dark-adaptation kinetics

This demonstrates that these three proteins function cooperatively in the clearance of all-trans-retinal from photoreceptors, with their combined loss leading to severe pathology.

How can the relative contributions of RDH8 versus other retinol dehydrogenases be quantified?

Determining the relative contributions of different retinol dehydrogenases requires careful experimental design:

Recommended approach:

  • Use detergent-free assays and HPLC-based methodology for side-by-side characterization

  • Compare kinetic parameters (Km, kcat, kcat/Km) across different enzymes under identical conditions

  • Examine activity in the presence of cellular retinol binding proteins

  • Complement in vitro studies with cell culture and knockout animal models

This comprehensive approach provides a more accurate assessment of the relative physiological roles of different enzymes in retinoid metabolism.

What are the current challenges in studying RDH8 function in vivo?

Several challenges exist in studying RDH8 function in vivo:

  • Overlapping functions with other retinol dehydrogenases, particularly RDH12

  • Compartmentalization of retinoid metabolism in photoreceptors (outer vs. inner segments)

  • Interaction complexity with cellular retinoid binding proteins and transporters

  • Disease heterogeneity - mutations in RDH8 may contribute to different phenotypes depending on genetic background

Future research should focus on developing more specific inhibitors, creating conditional knockout models, and utilizing advanced imaging techniques to overcome these challenges.

What commercially available tools exist for studying human RDH8?

For researchers interested in studying human RDH8, several commercial tools are available:

  • ELISA Kits: The GENLISA Human Retinol Dehydrogenase 8 (RDH-8/RDH8) ELISA is validated for measuring RDH8 in human serum, plasma, biological fluids, and cell culture supernatant

What animal models are most appropriate for studying RDH8 function?

Mouse models have been extensively used to study RDH8 function:

  • Single knockout (Rdh8−/−)

  • Combined knockouts:

    • Rdh8−/−Rdh12−/−

    • Rdh8−/−Abca4−/−

    • Rdh8−/−Rdh12−/−Abca4−/−

These models have revealed crucial insights into the redundancy and cooperation between different components of the visual cycle. The triple knockout mice (Rdh8−/−Rdh12−/−Abca4−/−) exhibit particularly severe retinal degeneration, making them valuable models for studying retinal degenerative diseases .

What are promising targets for therapeutic intervention in diseases associated with RDH8 dysfunction?

Based on current understanding of RDH8 function, several therapeutic approaches could be considered:

  • Enzyme replacement or enhancement to improve all-trans-retinal clearance

  • Reduction of all-trans-retinal accumulation through complementary pathways

  • Prevention of toxic byproduct formation (such as A2E)

  • Gene therapy targeting the RDH8 gene, particularly for Stargardt disease cases with identified mutations

The recent identification of RDH8 mutations in Stargardt disease opens new avenues for targeted therapies in this previously untreatable condition .

How might high-throughput screening be applied to identify modulators of RDH8 activity?

High-throughput screening for RDH8 modulators could employ:

  • Fluorescence-based assays measuring the conversion of retinal to retinol

  • Cell-based reporter systems expressing RDH8 and downstream signaling components

  • Differential scanning fluorimetry to identify stabilizing compounds

  • Virtual screening against the RDH8 structural model followed by targeted biochemical validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.