Recombinant Human Rhomboid domain-containing protein 2 (RHBDD2)

Shipped with Ice Packs
In Stock

Description

Retinal Function

  • RHBDD2 is critical for retinal development and photoreceptor function. A homozygous R85H mutation in RHBDD2 co-segregates with autosomal recessive retinitis pigmentosa, linking it to retinal degeneration .

  • Localizes to cone outer segments and interacts with S- and M-cone opsins .

Cancer Relevance

  • Overexpression in tumors: Elevated RHBDD2 mRNA and protein levels correlate with advanced-stage breast cancer (stage III, p = 0.001) and poor prognosis .

  • Splicing variants:

    • RHBDD2-2 (isoform B) is upregulated in basal-like breast cancer, associated with chemotherapy resistance .

    • Silencing RHBDD2 reduces MCF7 breast cancer cell proliferation (p = 0.001) .

StudyKey FindingReference
TCGA-BRCA RNA-SeqRHBDD2-2 overexpression linked to basal-like subtype and worse patient outcomes
ImmunohistochemistryRHBDD2 overexpression in 21% of invasive breast carcinomas
Survival analysisHigh RHBDD2 expression reduces relapse-free survival (p = 0.0013)

Interaction Partners and Pathways

RHBDD2 interacts with proteins involved in endoplasmic reticulum-associated degradation (ERAD) and cellular stress responses:

PartnerFunctionInteraction Score
RHBDF1Regulates ADAM17 protease, impacting EGFR ligand shedding and inflammation0.666
DERL2Mediates retrotranslocation of misfolded glycoproteins for proteasomal degradation0.636
WWOXCo-localizes in Golgi; interaction decreases during cellular differentiation

These interactions suggest roles in protein quality control and cancer progression .

Research Applications

  • Functional studies: Investigating RHBDD2’s role in ERAD, photoreceptor maintenance, and tumorigenesis .

  • Therapeutic targeting: siRNA-mediated knockdown reduces cancer cell proliferation, highlighting its potential as a therapeutic target .

  • Diagnostic biomarker: Overexpression correlates with aggressive breast cancer subtypes and chemoresistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHBDD2; RHBDL7; Rhomboid domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RHBDD2
Target Protein Sequence
MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQV YRLVTYIFVYENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAV SSLSKLGEVEDARGFTPVAFAMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQ TSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERR AAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPA SGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSR VPMP
Uniprot No.

Target Background

Gene References Into Functions
  1. RHBDD2 subcellular localization has been confirmed in the Golgi apparatus. PMID: 29901166
  2. RHBDD2 overexpression in breast cancer may represent an adaptive response to the stressful tumor microenvironment by modulating the endoplasmic reticulum stress response. PMID: 24078384
  3. Quantitative RT-PCR analysis revealed significant RHBDD2 mRNA overexpression in advanced breast cancer compared to normal tissue (p = 0.012). PMID: 24185965
  4. RHBDD2 plays a crucial role in retinal development and function. PMID: 23386608
  5. Increased RHBDD2 expression in response to chemotherapy is associated with advanced colorectal cancer. PMID: 22965880
  6. RHBDD2 overexpression correlates with poor prognosis and may contribute to breast cancer progression. PMID: 19616622
Database Links

HGNC: 23082

OMIM: 615203

KEGG: hsa:57414

STRING: 9606.ENSP00000006777

UniGene: Hs.488827

Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is RHBDD2 and how is it classified within the rhomboid protein family?

RHBDD2 (Rhomboid Domain-Containing Protein 2) belongs to the rhomboid family of multi-transmembrane proteins. While many rhomboid proteins function as intramembrane serine proteases that cleave transmembrane substrates within lipid bilayers, RHBDD2 is part of a subgroup that may have distinct functions from the proteolytically active members. The rhomboid family includes both active proteases and inactive members (pseudoproteases), with RHBDD2 being less extensively characterized than other family members such as RHBDL4, which has a documented role in endoplasmic reticulum protein quality control .

To study RHBDD2's classification and structural features, researchers should:

  • Perform sequence alignment with other rhomboid family members

  • Identify conserved domains through bioinformatic approaches

  • Analyze transmembrane topology predictions

  • Consider expressing recombinant protein for structural studies

What are the known alternatively spliced isoforms of RHBDD2 and their significance?

Research has identified at least two alternatively spliced mRNA isoforms of RHBDD2 expressed in breast cancer cell lines. These isoforms were characterized through Western blot, RT-PCR, and cDNA sequencing analyses . The functional differences between these isoforms remain to be fully elucidated.

For researchers studying RHBDD2 isoforms, it is essential to:

  • Design primers that can distinguish between different isoforms

  • Use isoform-specific antibodies when available

  • Consider the potential impact of isoform-specific functions in experimental design

  • Analyze isoform expression patterns across different tissues and disease states

What are the recommended methods for detecting RHBDD2 expression in tissue samples?

Based on published research, several complementary approaches have proven effective for detecting RHBDD2 expression:

  • mRNA detection: Serial Analysis of Gene Expression (SAGE) has been successfully used to identify elevated RHBDD2 mRNA levels in breast carcinomas compared to normal breast samples .

  • Protein detection: Immunohistochemistry (IHC) has been employed to assess RHBDD2 protein expression in tissue microarrays. In a study of 213 breast samples, IHC revealed significantly elevated RHBDD2 protein in carcinomas compared to normal samples .

  • Gene amplification: Techniques to assess gene copy number, such as fluorescence in situ hybridization (FISH) or quantitative PCR, can detect RHBDD2 amplification, which was found in 21% of invasive breast carcinomas but absent in normal breast tissues and benign lesions .

  • Western blotting: For protein expression analysis in cell lines and tissue lysates.

Researchers should consider using multiple detection methods for comprehensive analysis, as protein expression may not always correlate with mRNA levels or gene amplification.

What are effective approaches for modulating RHBDD2 expression in experimental models?

For investigating RHBDD2 function through expression modulation:

  • RNA interference: siRNA-mediated silencing has been effectively used to decrease RHBDD2 expression in breast cancer cell lines including MCF7 and T47D. This approach revealed that RHBDD2 knockdown results in decreased cell proliferation (p=0.001) and alterations in multiple cellular pathways .

  • Expression vectors: For overexpression studies, researchers have used vectors containing the RHBDD2 coding sequence.

  • CRISPR-Cas9: While not explicitly mentioned in the provided search results, this gene editing approach could be used for creating knockout or knock-in models.

When designing silencing experiments, researchers should:

  • Validate knockdown efficiency at both mRNA and protein levels

  • Use multiple siRNA sequences to minimize off-target effects

  • Include appropriate controls (scrambled siRNA)

  • Consider the timing of analysis after knockdown, as transient effects may differ from stable knockdown

How is RHBDD2 associated with breast cancer progression and prognosis?

RHBDD2 has shown significant associations with breast cancer progression and poor prognosis:

These findings collectively suggest that RHBDD2 overexpression serves as an indicator of poor prognosis and may actively facilitate breast cancer progression.

What other cancer types show significant RHBDD2 dysregulation?

Beyond breast cancer, RHBDD2 dysregulation has been observed in:

  • Colorectal cancer: Significant RHBDD2 mRNA and protein overexpression has been identified in advanced stages of colorectal cancer . This suggests that RHBDD2 up-modulation might be associated with malignant progression in multiple cancer types.

  • Response to chemotherapy: RHBDD2 protein expression was found to be upregulated in colon cancer cells treated with the chemotherapeutic agent 5-fluorouracil (5FU) . This suggests a potential role in treatment response or resistance mechanisms.

When investigating RHBDD2 in other cancer types, researchers should:

  • Compare expression patterns across cancer stages

  • Correlate with clinical outcomes and treatment responses

  • Consider tissue-specific functions and regulatory mechanisms

  • Evaluate potential as a biomarker in multiple cancer types

What signaling pathways are modulated by RHBDD2 in cancer cells?

Transcriptomic analysis of breast cancer cell lines with RHBDD2 knockdown has identified several pathways and biological processes modulated by this protein:

  • Protein metabolism: This was the most significantly enriched ontological term in gene expression studies. This cluster includes terms associated with ER stress biology such as protein folding, proteosomal degradation, ubiquitination, and translation .

  • Ribosomal biogenesis: Suggesting a role in protein synthesis regulation .

  • Oxidative phosphorylation: Indicating potential involvement in cellular energy metabolism .

  • Cell cycle regulation: Consistent with observed effects on cell proliferation .

  • Apoptosis: Suggesting RHBDD2 may influence cell survival pathways .

Analysis of RHBDD2 co-expressed genes across different tissues further strengthened the association with negative regulation of protein metabolism and vesicle-mediated transport .

For studying RHBDD2 signaling, researchers should:

  • Use pathway-specific reporter assays

  • Assess phosphorylation status of downstream signaling molecules

  • Consider cross-talk between identified pathways

  • Validate findings using multiple experimental approaches

How does RHBDD2 compare functionally to other rhomboid family proteins in cancer development?

While RHBDD2's specific function is still being characterized, comparison with other rhomboid family proteins offers insights:

  • RHBDF2 (iRhom2): This proteolytically inactive rhomboid protein has been implicated in renal clear cell carcinoma progression. High RHBDF2 expression correlates with poor survival rates. RHBDF2 functions are associated with:

    • Enhanced cell growth and migration

    • Immune suppression through sustained PD-L1 protein levels

    • EGFR signaling pathway activation

  • RHBDL4: This human rhomboid protease plays a critical role in removing misfolded proteins from the endoplasmic reticulum and is implicated in various cancers and Alzheimer's disease. It contains:

    • Six transmembrane helices

    • A serine-histidine catalytic dyad

    • Conserved rhomboid motifs

    • A p97/valosin-binding motif and ubiquitin interacting motif (UIM)

Understanding these related proteins may provide clues to RHBDD2's function, suggesting potential roles in:

  • Protein quality control

  • Growth factor signaling

  • Immune response modulation

  • Cellular stress responses

How can researchers develop effective inhibitors or modulators of RHBDD2 for experimental use?

While specific RHBDD2 inhibitors have not been described in the provided search results, the approach used for related rhomboid proteases like RHBDL4 offers valuable insights:

  • Assay development: Establish an in vitro FRET-based cleavage assay to measure RHBDD2 activity, similar to what has been done for RHBDL4 .

  • Substrate identification: Determine RHBDD2's substrate preferences through systematic testing of peptide libraries or candidate substrates.

  • Inhibitor design approaches:

    • Develop peptidyl α-ketoamide inhibitors based on substrate sequences

    • Utilize ensemble docking and molecular dynamics simulations to explore binding modalities

    • Focus on optimizing interactions with key residues in the active site

  • Testing pipeline:

    • Begin with in vitro assays using recombinant protein

    • Progress to testing in isolated cellular compartments (e.g., ER-enriched microsomes)

    • Finally evaluate efficacy in cellular models

Challenges may include:

  • Ensuring membrane penetrability of compounds

  • Accessing RHBDD2's active site in its native context

  • Achieving specificity among rhomboid family members

What are the molecular mechanisms underlying RHBDD2 gene amplification and overexpression in cancer?

This represents an advanced research question that has not been fully elucidated in the current literature. Based on the search results, researchers investigating this question should consider:

  • Genomic analysis:

    • Characterize the chromosomal region containing RHBDD2

    • Identify common breakpoints in amplified regions

    • Determine if RHBDD2 is co-amplified with nearby oncogenes

  • Transcriptional regulation:

    • Analyze the RHBDD2 promoter region for transcription factor binding sites

    • Investigate epigenetic modifications (DNA methylation, histone modifications)

    • Assess if cancer-specific transcription factors drive RHBDD2 expression

  • Post-transcriptional mechanisms:

    • Evaluate mRNA stability and potential regulation by microRNAs

    • Investigate alternative splicing regulation

  • Signaling feedback loops:

    • Determine if RHBDD2 participates in positive feedback loops that reinforce its expression

    • Investigate if RHBDD2 modulates pathways that further enhance its expression

What statistical approaches are recommended for analyzing RHBDD2 expression in relation to patient outcomes?

Based on published RHBDD2 research, the following statistical approaches are recommended:

  • Survival analysis:

    • Univariate Cox regression for initial association assessment

    • Kaplan-Meier survival curves with log-rank tests for significance testing

    • Multivariate analysis to adjust for confounding factors

  • Expression correlation:

    • Pearson correlation coefficient to determine relationships between RHBDD2 expression and other factors

    • Consider non-parametric alternatives (Spearman) when data is not normally distributed

  • Pathway analysis:

    • Weighted Gene Correlation Network Analysis (WGCNA) to identify significant functional modules based on RHBDD2 expression

    • Gene Set Enrichment Analysis (GSEA) for RHBDD2-related functions and signaling pathways

  • Comparative analysis:

    • Student's t-test for comparing two groups

    • One-way or two-way ANOVA for multiple group comparisons

    • Post-hoc testing for specific group differences

For all statistical analyses, a p-value threshold of <0.05 is typically considered significant, though adjustments for multiple testing should be employed when appropriate .

What controls and validation steps should be included when studying RHBDD2 function in cellular models?

When investigating RHBDD2 function in cellular models, researchers should implement these controls and validation steps:

  • Expression modulation validation:

    • Confirm RHBDD2 knockdown or overexpression at both mRNA and protein levels

    • Use multiple siRNA sequences or expression constructs

    • Include appropriate negative controls (scrambled siRNA, empty vectors)

  • Phenotypic assessments:

    • Perform experiments in multiple cell lines to ensure findings are not cell-line specific

    • Include time course analyses to capture both immediate and delayed effects

    • Repeat experiments at least 3 times for statistical reliability

  • Pathway validation:

    • Confirm pathway alterations using multiple methods (transcriptomics, proteomics)

    • Validate key findings with targeted experiments (e.g., qPCR for specific genes)

    • Use pathway inhibitors or activators to confirm causality

  • Rescue experiments:

    • Re-express RHBDD2 in knockdown models to confirm specificity of observed effects

    • Consider expression of specific isoforms or mutant variants

  • In vivo correlation:

    • Validate findings from cell models with patient sample data

    • Consider xenograft models for in vivo validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.