Recombinant Human Rhomboid-related protein 1 (RHBDL1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
RHBDL1; RHBDL; Rhomboid-related protein 1; RRP; Rhomboid-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RHBDL1
Target Protein Sequence
MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPAL WSRGRARTQALAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNE QGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPC EVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPG HRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGSLTVS ITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLR FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV FWNVFAYDLLGAHIPPPP
Uniprot No.

Target Background

Function
May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors.
Database Links

HGNC: 10007

OMIM: 603264

KEGG: hsa:9028

STRING: 9606.ENSP00000219551

UniGene: Hs.137572

Protein Families
Peptidase S54 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart, brain, skeletal muscle and kidney.

Q&A

What is Recombinant Human Rhomboid-related protein 1 (RHBDL1)?

RHBDL1 is a member of the rhomboid superfamily of intramembrane serine proteases. It exists as a 48kDa protein composed of 438 amino acids, with a shorter 41kDa isoform of 373 amino acids produced through alternative splicing . RHBDL1 contains several transmembrane domains and shares structural similarities with Rhomboid in Drosophila, which functions in developmental signaling pathways . As an intramembrane protease, RHBDL1 catalyzes proteolysis within the membrane environment, potentially regulating various signaling pathways by cleaving membrane-bound proteins.

For recombinant expression, RHBDL1 can be produced in E. coli expression systems, often with a polyhistidine (6*His) tag to facilitate purification . The recombinant protein typically includes specific regions of the native protein (e.g., amino acids 1-195) fused to purification tags .

Where is RHBDL1 localized within cells?

RHBDL1 is predominantly localized to the Golgi apparatus in mammalian cells . This localization is significant as it distinguishes RHBDL1 from other rhomboid family members, such as PARL (localized to mitochondria) and RHBDL4 (found in the endoplasmic reticulum) . The Golgi localization suggests that RHBDL1 may be involved in processing proteins as they traffic through the secretory pathway, potentially modifying secreted or membrane-bound proteins before they reach their final destination.

What is known about RHBDL1 structure and domains?

RHBDL1 contains multiple transmembrane domains characteristic of the rhomboid superfamily . The protein features a peptidase S54 rhomboid domain and belongs to the rhomboid-like superfamily . While high-resolution structural data specific to RHBDL1 is limited, domain analysis indicates it contains:

  • Peptidase S54 rhomboid domain

  • Peptidase S54 rhomboid, metazoan

  • Rhomboid-like superfamily domain

  • Rhomboid-related intramembrane serine protease domains

Like other rhomboid proteases, RHBDL1 likely possesses a catalytic dyad or triad with serine as the nucleophile, essential for its proteolytic activity. Structural modeling approaches using homology to bacterial rhomboid proteases could be employed to predict the three-dimensional structure of RHBDL1 .

What diseases has RHBDL1 been associated with?

Current research has linked RHBDL1 to several pathological conditions:

  • Leber hereditary optic neuropathy and general neuropathy

  • Various cancers, particularly colorectal cancer

Rhomboid family proteins, including RHBDL1, have been implicated in cancer, neurodegenerative disorders, metabolic diseases, and infectious diseases . The table below summarizes the reported associations between rhomboid family proteins and various cancers:

ProteinCancer TypeFindings
Rhbdl4Colorectal CancerHigh expression associated with metastatic colorectal cancer; involved in Wnt and EGFR signaling pathways
Rhbdl4GlioblastomaKnockdown resulted in increased apoptosis in glioblastoma-derived cell lines
iRhom1Breast CancerElevated expression correlated with faster progression; promotes stability of Hif1α transcription factor
Derlin-1Colon CancerSilencing led to growth inhibition and promoted apoptosis; overexpression correlates with tumor differentiation, invasion, and metastasis

The relationship between RHBDL1 and disease pathogenesis remains an active area of research with potential therapeutic implications.

How does RHBDL1 differ from other rhomboid family proteins in substrate specificity?

RHBDL1, as a eukaryotic Golgi-localized rhomboid protease, likely exhibits distinct substrate preferences compared to bacterial rhomboid proteases . While bacterial rhomboids typically prefer substrates with small side chain residues in the P1 position, eukaryotic rhomboid proteases may have evolved different specificities .

For comparison, the mitochondrial rhomboid protease PARL shows an unusual preference for phenylalanine (Phe) in the P1 position, which is rare among bacterial rhomboids (with the exception of YqgP from Bacillus subtilis) . This suggests evolutionary divergence in substrate recognition among rhomboid family members.

Although the substrate specificity of RHBDL1 has not been comprehensively characterized, its evolutionary relationship with other eukaryotic rhomboid proteases suggests it may have co-evolved with specific substrates to recognize distinct motifs. The preferences for Golgi-localized RHBDL1 and ER-localized RHBDL4 remain to be determined , representing an important area for future investigation.

What is RHBDL1's role in growth factor signaling pathways?

RHBDL1 shares significant homology with Drosophila Rhomboid, which plays a critical role in the Spitz/EGFR/MAPK signaling pathway . In Drosophila, Rhomboid cleaves membrane-bound Spitz precursor to release the active ligand, which subsequently activates the EGFR.

By analogy, RHBDL1 may process membrane-bound growth factor precursors in humans, contributing to EGFR signaling regulation. Research has linked Rhomboid domain containing proteins to colorectal cancer growth through activation of the EGFR signaling pathway . The evolutionary conservation between RHBDL1 and Drosophila Rhomboid suggests preservation of this critical signaling function.

Additional evidence suggests rhomboid family members may regulate cell survival through mechanisms involving AP-1 activity and its downstream target Bcl-3 , as well as BIK-mediated apoptosis . RHBDL4, another family member, has been implicated in alternative processing of the amyloid precursor protein family , suggesting diverse roles for rhomboid proteases in various signaling networks.

How do alternative splicing events affect RHBDL1 function?

RHBDL1 exists in multiple isoforms due to alternative splicing, including a full-length 48kDa protein (438 amino acids) and a shorter 41kDa isoform (373 amino acids) . These different isoforms likely possess distinct functional properties, potentially including:

  • Different substrate specificities

  • Altered subcellular localization patterns

  • Modified regulatory mechanisms

  • Varied interaction partners

Alternative splicing can significantly affect protein structure and function by including or excluding specific domains or motifs that influence:

  • Enzymatic activity

  • Interaction with binding partners

  • Integration into cellular membranes

  • Regulatory control mechanisms

The presence of alternative splicing in RHBDL1 suggests a mechanism for fine-tuning its activity in different cellular contexts or developmental stages. Comparative functional studies of RHBDL1 isoforms would provide valuable insights into how alternative splicing contributes to the regulation of this protein.

What is the potential role of RHBDL1 in cancer progression?

Emerging evidence suggests RHBDL1 and related rhomboid family proteins may play significant roles in cancer progression . While specific mechanisms for RHBDL1 are still being elucidated, several potential cancer-related functions have been proposed:

  • Regulation of growth factor signaling through processing of membrane-bound precursors

  • Modulation of cell survival pathways and apoptosis resistance

  • Influence on protein trafficking and cellular stress responses

  • Potential impacts on cell migration and invasion processes

Research on related rhomboid proteins has shown that:

  • Rhomboid domain containing proteins can promote colorectal cancer growth through EGFR signaling pathway activation

  • Rhomboid proteins can inhibit cell apoptosis by upregulating AP-1 activity and its downstream target Bcl-3

  • RHBDL4 has been associated with colorectal cancer and glioblastoma

The involvement of RHBDL1 in growth factor signaling pathways suggests it could contribute to cancer cell proliferation, survival, and potentially metastasis, making it an interesting target for further cancer research.

What expression systems are most effective for producing recombinant RHBDL1?

Based on published research, E. coli has been successfully employed as an expression host for recombinant human RHBDL1 . A typical approach involves expressing a construct containing amino acids 1-195 of human RHBDL1 (XP_016879338.1) fused with a polyhistidine tag . This method has yielded protein with approximately 85% purity as assessed by SDS-PAGE with Coomassie Brilliant Blue staining .

For membrane proteins like RHBDL1, several expression systems may be considered:

Expression SystemAdvantagesLimitations
E. coliCost-effective, high yield, simple cultureLimited post-translational modifications, potential inclusion body formation
Yeast (S. cerevisiae/P. pastoris)Eukaryotic modifications, higher yields than mammalian cellsGlycosylation patterns differ from human
Insect cells (Sf9, Hi5)More human-like modifications, good for membrane proteinsMore complex, moderate yield
Mammalian cells (HEK293, CHO)Native post-translational modificationsLow yield, expensive, technically challenging

For functional studies requiring properly folded, active RHBDL1, eukaryotic expression systems may offer advantages, particularly if post-translational modifications are critical for activity. The choice should be guided by specific research requirements, including the need for post-translational modifications, protein solubility, and functional activity.

What purification strategies are recommended for recombinant RHBDL1?

For efficient purification of recombinant RHBDL1, a multi-step strategy is recommended:

  • Primary affinity chromatography: Utilizing polyhistidine (6*His) tag affinity chromatography with metal chelate resins (Ni-NTA, Co-TALON) . Elution typically employs imidazole gradient or pH reduction.

  • Secondary purification steps: For higher purity (>85% achieved in published protocols ), consider:

    • Ion exchange chromatography

    • Size exclusion chromatography

    • Hydrophobic interaction chromatography

  • Membrane protein considerations: RHBDL1, being a membrane protein, requires maintenance in a suitable detergent environment throughout purification. Detergents like DDM (n-dodecyl β-D-maltoside) are commonly used for rhomboid proteases .

  • Quality control: Assess purity by SDS-PAGE with Coomassie Brilliant Blue staining , and consider activity assays to confirm functional integrity.

Optimization of purification conditions (pH, salt concentration, detergent type and concentration) should be empirically determined based on specific research requirements and the intended use of the purified protein.

How can the enzymatic activity of recombinant RHBDL1 be assessed?

Assessing enzymatic activity of recombinant RHBDL1 requires monitoring the cleavage of appropriate substrates. While specific RHBDL1 activity assays are not fully detailed in the literature, approaches can be adapted from methods used for related rhomboid proteases:

  • In-solution activity assays:

    • Enzyme preparation: Purified RHBDL1 in detergent micelles (DDM) or reconstituted in proteoliposomes

    • Substrate addition: Known or potential substrate proteins at varying concentrations

    • Reaction conditions: Optimized buffer, pH, temperature, and incubation time

    • Detection methods: SDS-PAGE, western blotting, or mass spectrometry to identify cleavage products

  • Kinetic analysis:

    • Measure initial reaction rates at varying substrate concentrations

    • Determine Km, Vmax, and catalytic efficiency (kcat/Km)

    • Compare activity under different conditions or with mutant variants

  • Inhibition studies:

    • Pre-incubate enzyme with potential inhibitors before substrate addition

    • Determine IC50 values and inhibition mechanisms

  • Cleavage site identification:

    • Edman degradation of cleavage products

    • Mass spectrometry analysis

    • Mutational analysis of putative cleavage sites

When developing an activity assay for RHBDL1, incorporate appropriate positive controls (known active rhomboid proteases) and negative controls (catalytically inactive mutants or no-enzyme controls).

What controls should be included when studying RHBDL1 function in cell culture?

Robust experimental design for studying RHBDL1 function in cell culture requires comprehensive controls:

  • Expression controls:

    • Western blotting to confirm RHBDL1 overexpression or knockdown

    • qPCR to verify changes at the mRNA level

    • Immunofluorescence to confirm subcellular localization

  • Functional controls:

    • Catalytically inactive RHBDL1 mutant (mutation of active site serine)

    • Rescue experiments (reintroducing wild-type RHBDL1 in knockdown cells)

    • Comparison with other rhomboid family members

  • Pathway controls:

    • Positive controls for expected downstream effects (e.g., EGFR pathway activation)

    • Inhibitors of related pathways to confirm specificity

    • Monitoring of multiple pathway components

  • Subcellular localization controls:

    • Co-localization with Golgi markers

    • Subcellular fractionation

    • Mutants with altered localization signals

  • Experimental technique controls:

    • Empty vector/scrambled siRNA controls

    • Transfection efficiency monitoring

    • Cell viability assessments

Implementation of these controls ensures experimental validity and facilitates accurate interpretation of results related to RHBDL1 function.

How do I troubleshoot inconsistent results in RHBDL1 activity assays?

When encountering variability in RHBDL1 activity assays, systematic troubleshooting is essential:

  • Protein-related factors:

    • Verify protein quality and purity via SDS-PAGE and western blotting

    • Check protein stability under assay conditions

    • Ensure proper folding and membrane/detergent environment

    • Confirm active site integrity

  • Assay conditions optimization:

    • Systematically vary buffer composition, pH, temperature

    • Test different detergent types and concentrations

    • Evaluate ionic strength effects

    • Optimize enzyme:substrate ratios

  • Substrate considerations:

    • Assess substrate quality and potential degradation

    • Verify substrate solubility and proper presentation

    • Consider testing multiple substrate candidates

  • Technical parameters:

    • Standardize incubation times and temperatures

    • Minimize pipetting errors through proper technique

    • Ensure consistent detection methods and analysis

  • Special considerations for membrane proteins:

    • For proteoliposome assays, verify consistent protein incorporation

    • Control lipid composition effects on activity

    • Ensure proper protein orientation in membranes

Creating a detailed troubleshooting log that tracks all experimental variables can help identify patterns in inconsistent results and guide optimization efforts.

How should contradictory findings regarding RHBDL1's role in specific diseases be interpreted?

When facing contradictory findings regarding RHBDL1's role in diseases, employ this analytical framework:

  • Contextual differences:

    • Compare experimental models (cell lines vs. animal models vs. patient samples)

    • Evaluate disease subtypes and progression stages

    • Consider tissue-specific effects and microenvironmental factors

  • Methodological variations:

    • Assess differences in experimental approaches (overexpression vs. knockdown)

    • Evaluate antibody specificity and detection methods

    • Compare endpoint measurements and analytical techniques

  • Molecular considerations:

    • Determine which RHBDL1 isoforms were studied

    • Consider post-translational modifications

    • Evaluate interaction with different signaling networks

  • Statistical and reporting factors:

    • Assess statistical power and sample sizes

    • Consider publication bias toward positive findings

    • Evaluate strength of evidence and reproducibility

  • Reconciliation approaches:

    • Propose conditional models (RHBDL1 function may be context-dependent)

    • Design experiments that directly address contradictions

    • Consider systems biology approaches to map complex interactions

The role of rhomboid proteases in diseases like cancer appears complex and potentially context-dependent , suggesting that contradictory findings may reflect biological complexity rather than experimental error.

What statistical approaches are appropriate for analyzing RHBDL1 expression across tissues?

Analysis of RHBDL1 expression across tissues requires appropriate statistical methodologies:

  • Descriptive statistics:

    • Calculate mean, median, standard deviation for expression levels

    • Generate box plots or violin plots to visualize distribution patterns

    • Determine coefficient of variation to assess relative variability

  • Comparative analyses:

    • ANOVA (Analysis of Variance) for multi-tissue comparisons

    • Post-hoc tests (Tukey's HSD, Bonferroni) for specific pairwise comparisons

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U) for non-normal distributions

  • Correlation approaches:

    • Pearson/Spearman correlation between RHBDL1 and potential interacting partners

    • Regression analysis for modeling relationships with clinical parameters

    • Network analysis for pathway associations

  • Multiple testing corrections:

    • Bonferroni correction for stringent family-wise error rate control

    • Benjamini-Hochberg procedure for false discovery rate control

    • Q-value calculations for large-scale analyses

  • Visualization techniques:

    • Heat maps for multi-tissue expression patterns

    • Volcano plots for differential expression analysis

    • Principal component analysis plots for dimensional reduction

When analyzing RHBDL1 expression in disease contexts, consider stratifying by relevant clinical parameters and employing matched-pair analyses when appropriate.

What are promising directions for advancing RHBDL1 research?

Based on current knowledge gaps and emerging techniques, several research directions hold particular promise:

  • Comprehensive substrate identification:

    • Proteomics-based approaches to identify physiological substrates

    • Determination of cleavage site specificity and recognition motifs

    • Validation of substrate processing in relevant cellular contexts

  • Structural biology advances:

    • High-resolution structural determination using cryo-electron microscopy

    • Molecular dynamics simulations of substrate binding and catalysis

    • Structure-based design of specific inhibitors or activity modulators

  • Physiological function elucidation:

    • Development of tissue-specific and inducible knockout models

    • Investigation of RHBDL1's role in intracellular signaling networks

    • Characterization of isoform-specific functions

  • Disease relevance exploration:

    • Further investigation of roles in Leber hereditary optic neuropathy

    • Expanded studies in cancer biology, particularly colorectal cancer

    • Evaluation as potential diagnostic/prognostic biomarker

  • Technological innovations:

    • Development of specific activity-based probes

    • Implementation of advanced imaging approaches for real-time activity monitoring

    • CRISPR-based functional genomics studies

  • Therapeutic development:

    • Design of specific inhibitors based on structural insights

    • Exploration of substrate-targeting approaches

    • Investigation of potential in precision medicine applications

These research directions would significantly advance our understanding of RHBDL1's fundamental biology and potential clinical relevance.

What are the limitations of current experimental models for studying RHBDL1?

Current experimental approaches for studying RHBDL1 face several significant limitations:

  • In vitro systems constraints:

    • Recombinant proteins may lack critical post-translational modifications

    • Detergent micelles inadequately mimic native membrane environments

    • Difficulties in maintaining long-term protein stability

    • Potential differences between truncated constructs and full-length protein

  • Cell culture model limitations:

    • Cell lines may lack physiologically relevant interaction partners

    • Overexpression systems may create non-physiological conditions

    • Knockdown strategies often achieve incomplete silencing

    • Challenges in distinguishing direct from indirect effects

  • Animal model challenges:

    • Species differences in RHBDL1 expression and regulation

    • Potential compensatory mechanisms from other rhomboid family members

    • Complex phenotypes may be difficult to attribute specifically to RHBDL1

    • Translational relevance to human diseases requires careful validation

  • Technical hurdles:

    • Limited availability of highly specific antibodies

    • Challenges in distinguishing between RHBDL1 isoforms

    • Difficulties in detecting low-abundance cleavage products

    • Limited ability to monitor real-time protease activity in cells

  • Structural knowledge gaps:

    • Lack of high-resolution structures for human RHBDL1

    • Incomplete understanding of substrate binding mechanisms

    • Limited knowledge of conformational dynamics during catalysis

Addressing these limitations through emerging technologies such as cryo-electron microscopy, advanced proteomics, and CRISPR/Cas9 genome editing will be crucial for advancing our understanding of RHBDL1 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.