Recombinant Human Ribonuclease kappa (RNASEK)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Catalytic Activity

RNASEK exhibits distinct substrate specificity and resistance to inhibitors, distinguishing it from other ribonucleases:

PropertyDetailsReferences
Substrate SpecificityPreferentially cleaves ApU and ApG phosphodiester bonds; slower hydrolysis of UpU
pH ToleranceActive across pH 5–8, with optimal activity at neutral pH
Ion SensitivityResistant to EDTA (up to 20 mM) and NaCl (up to 250 mM); inhibited by Zn²⁺
Inhibitor ResistanceNot affected by placental ribonuclease inhibitor
ThermolabilityLoses activity at 60°C for 10 min; fully inactivated at 90°C

Viral Entry and Infection

RNASEK is critical for the internalization of acid-dependent viruses:

  • Mechanism: Facilitates clathrin-mediated endocytosis (CME) but is dispensable for general endocytic uptake .

  • Viral Targets: Required for infection by dengue, West Nile, Sindbis, Rift Valley Fever, influenza, and PEDV viruses .

  • Interactions: Binds directly to viral structural proteins (e.g., PEDV S2, M, E) .

Immune Response and Apoptosis

  • Type I Interferon Regulation: Overexpression enhances interferon production in fish models, suggesting a role in innate immunity .

  • Apoptosis: Promotes cell death in fish models via Bax/Bcl-2 ratio modulation and DNA fragmentation .

Expression Systems

Host OrganismOutcomeReferences
E. coliToxicity observed; low yield of soluble protein
Pichia pastorisSuccessful secretion with His-tag; high enzymatic activity

Key Studies on RNASEK’s Role in Viral Infection

VirusEntry PathwayRNASEK DependencyReferences
DengueClathrin-mediatedEssential for internalization
Influenza AAcid-dependentRequired for viral uptake
PEDVClathrin-mediatedBinds S2, M, E proteins; enhances entry

Mechanistic Insights

  • Endosomal Pathway: Depletion of RNASEK enlarges clathrin-coated pits (CCPs), impairing viral internalization .

  • EPS15-Clathrin Interaction: Facilitates PEDV virion interaction with the EPS15-clathrin complex .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder forms.
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Typically, we can ship your order within 1-3 business days of receipt. Delivery times may vary based on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
RNASEK; Ribonuclease kappa; RNase K; RNase kappa
Datasheet & Coa
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
RNASEK
Target Protein Sequence
MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Ribonuclease kappa (RNASEK) is an endoribonuclease that preferentially cleaves ApU and ApG phosphodiester bonds. It hydrolyzes UpU bonds at a slower rate.

In the context of microbial infection, RNASEK plays a crucial role in the early stages of clathrin-mediated endocytic uptake of a variety of viruses, including dengue, West Nile, Sindbis, Rift Valley Fever, and influenza viruses. However, it is not required for clathrin-mediated endocytosis or macropinocytosis.
Gene References Into Functions
  1. Low RNASEK expression is associated with prostate cancer. PMID: 30054827
  2. Analyses of global gene expression data from adipose tissue, skeletal muscle, and whole blood suggest that rs75493593 is associated with RNASEK gene expression. This suggests that RNASEK expression may mediate the effect of genotype on diabetes. PMID: 26487785
  3. RNASEK closely associates with the V-ATPase and is essential for its function. Its loss prevents the early events of endocytosis and the replication of multiple pathogenic viruses. PMID: 26212330
  4. Data suggest that the Cys6-Cys69 disulfide bond likely exists in all RNase kappa family members, including humans. PMID: 22324914
  5. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  6. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  7. Based on sequence alignment and substrate specificity data, as well as the resistance of the protein to the placental ribonuclease inhibitor, human RNase kappa may be a novel endoribonuclease distinct from other known ribonucleases. PMID: 17881363

Show More

Hide All

Database Links

HGNC: 33911

KEGG: hsa:440400

STRING: 9606.ENSP00000449500

UniGene: Hs.632232

Protein Families
RNase K family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the basic structure and conservation pattern of human RNASEK?

Human RNASEK belongs to a novel ribonuclease family first characterized in the insect Ceratitis capitata. The human ortholog consists of 98 amino acids and shares remarkably high conservation (>98% identity) with mammalian counterparts. The protein shows approximately 51% homology between Drosophila and humans, indicating evolutionary importance . This high degree of conservation suggests essential biological functions that have been preserved across species throughout evolution. Structurally, RNASEK is distinct from other known ribonucleases based on amino acid sequence alignment and substrate specificity analysis.

What enzymatic activity does RNASEK demonstrate?

RNASEK functions as an endoribonuclease with distinct substrate preferences. Experimental characterization using 5'-end-labeled RNA probes as substrates has demonstrated that the purified recombinant enzyme preferentially cleaves ApU and ApG phosphodiester bonds, while hydrolyzing UpU bonds at a significantly lower rate . Notably, RNASEK exhibits complete resistance to placental ribonuclease inhibitor, further distinguishing it from other ribonucleases and suggesting specialized cellular functions . This unique enzymatic profile makes RNASEK an interesting subject for both basic research and potential applications in understanding RNA processing mechanisms.

How is RNASEK gene expression regulated in different tissues?

RNASEK is encoded by a single-copy gene that is expressed across a wide spectrum of normal and cancer tissues . Expression analysis of RNASEK and its splice variants can be accurately quantified using real-time PCR methods employing distinctive restriction sites . Current evidence suggests that RNASEK expression may vary between tissues and cell types, potentially in response to developmental stages or external factors. The ratio between RNASEK isoforms can differ across various tissues, suggesting tissue-specific regulation mechanisms that may correlate with specialized functions .

What are the challenges in recombinant expression of human RNASEK?

Recombinant expression of human RNASEK presents significant technical challenges. When the cDNA is subcloned into various prokaryotic expression vectors, most expression attempts cause severe toxic effects to the host cells . This toxicity likely stems from the ribonuclease activity interfering with host cell RNA processing. Researchers have successfully overcome this limitation by utilizing the methylotrophic yeast Pichia pastoris expression system, which resulted in the production of highly active recombinant enzyme . This methodological approach represents an important consideration for researchers seeking to produce functional RNASEK for experimental studies.

How can researchers detect and quantify RNASEK splice variants?

For detecting subtle alternative splicing events in RNASEK, conventional methods like gel electrophoresis may lack sufficient resolution. An effective methodological approach involves a hybrid selection step combined with restriction enzyme digestion that specifically acts against complementary sequences of the undesired variant . This technique allows for selective amplification of specific transcript variants even when they differ by only a few nucleotides. For quantification, real-time PCR approaches utilizing distinctive restriction sites can accurately measure the expression ratio between variant sequences. This method offers advantages over traditional approaches like polyacrylamide gel electrophoresis, agarose gel electrophoresis, or capillary electrophoresis, which may not provide accurate results for subtle splice variants .

What RNA-seq experimental design considerations are crucial for studying RNASEK expression?

When designing RNA-seq experiments to study RNASEK expression, several parameters require careful consideration. These include the number of biological replicates (minimum 3-5 recommended for statistical power), read depth (depending on expected expression level), sequence read length (longer reads improve transcript identification), and whether to perform paired-end or single-end sequencing . For differential expression analysis of RNASEK across conditions, paired-end sequencing is preferable as it provides better transcript isoform resolution. Quality control, appropriate read alignment, and accurate assignment of reads to genes or transcripts are critical steps in the analysis pipeline. Tool selection for differential expression analysis should be based on the specific experimental design and research questions .

Which viruses require RNASEK for successful infection?

RNASEK has been identified as essential for the infection of numerous viruses that enter cells through acid-dependent pathways. Experimental evidence demonstrates that RNASEK is required for infection by diverse and unrelated positive- and negative-strand-enveloped viruses from multiple families including:

  • Flaviviridae (West Nile virus, dengue virus)

  • Togaviridae (Sindbis virus)

  • Bunyaviridae (Rift Valley Fever virus)

  • Orthomyxoviridae (influenza A virus subtypes H1N1 and H3N2)

Importantly, RNASEK appears dispensable for viruses that enter at the plasma membrane, such as parainfluenza virus 5 and Coxsackie B virus . This pattern indicates RNASEK's specific role in endosomal entry pathways rather than a general requirement for all viral infections.

How does RNASEK depletion affect different stages of the viral life cycle?

Depletion of RNASEK significantly attenuates viral infection at early time points post-infection, suggesting its role early in the viral life cycle . Studies monitoring infection by West Nile virus at 8 hours post-infection showed significantly decreased infection in RNASEK-depleted cells. Additionally, acid bypass assays suggest that RNASEK is required for viral uptake or for the acidification of endosomal compartments. The effect of RNASEK depletion appears to be specific to virus internalization, as it does not affect general cellular endocytosis machinery . This specificity makes RNASEK a particularly interesting target for antiviral strategies that would not disrupt essential cellular functions.

What alternative splicing events occur in the RNASEK gene?

RNASEK undergoes subtle alternative splicing events that lead to the formation of RNA variants differing by only a small number of nucleotides. One well-characterized variant is RNase κ-02, which occurs as a result of an alternative Δ4 donor event within the first intron of the gene . This type of subtle splicing (involving just a few nucleotides) is considered quite frequent in human gene products. The functional significance of these subtle splice variants may relate to differential regulation of expression levels across various tissues and cell types, during developmental stages, or in response to external factors .

How can researchers experimentally validate subtle splice variants of RNASEK?

Validating subtle splice variants that differ by only a few nucleotides requires specialized methodological approaches. An effective strategy involves:

  • Initial PCR amplification of the target region

  • Digestion with restriction enzymes that specifically recognize sequences in the predominant isoform

  • A hybrid selection step that permits isolation of rare transcripts in sequence-specific manner

  • Further amplification of the selected variant

This approach offers significant advantages over conventional RT-PCR methods by removing abundant RNA molecules (like ribosomal RNAs and highly expressed mRNAs) that might hinder detection of low-expression transcripts . The addition of a digestion step with an appropriate restriction enzyme specifically acting against complementary sequences allows for selective amplification of the unaffected molecules, facilitating the isolation and characterization of subtle splice variants.

What is the significance of differential expression of RNASEK splice variants?

The ratio between short-distance splice isoforms of RNASEK may differ across tissues and cell types, during developmental stages, or in response to external factors . This differential regulation of subtle alternative splicing isoforms may indicate specialized functions. Quantitative analysis of these expression patterns can provide insights into tissue-specific roles of RNASEK and its potential involvement in developmental processes or response to stimuli. Real-time PCR methods utilizing distinctive restriction sites provide accurate quantification of variant expression ratios, offering advantages over traditional methods like gel electrophoresis or capillary electrophoresis .

How might RNASEK be exploited as an antiviral target?

RNASEK represents a potentially viable therapeutic target for inhibiting major human viral pathogens for several compelling reasons:

  • It is required for infection by diverse viruses of medical concern that enter through acid-dependent pathways

  • Its requirement appears specific for viral entry rather than general endocytosis

  • It functions at an early stage in the viral life cycle, preventing establishment of infection

Given that RNASEK is dispensable for general endocytic uptake of transferrin, therapeutic targeting might achieve antiviral effects without disrupting essential cellular processes . Development of small-molecule inhibitors or other therapeutic approaches targeting RNASEK could potentially provide broad-spectrum antiviral activity against multiple families of medically important viruses including flaviviruses, alphaviruses, bunyaviruses, and influenza viruses.

What experimental approaches can determine the structural basis of RNASEK's role in viral entry?

Advanced structural biology approaches would be valuable for elucidating the precise mechanism by which RNASEK facilitates viral entry. These might include:

  • Cryo-electron microscopy to visualize RNASEK in complex with viral or cellular components

  • X-ray crystallography of RNASEK alone or in complex with interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in protein-protein interactions

  • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to RNASEK during viral entry

  • Site-directed mutagenesis coupled with functional assays to identify critical residues

These approaches, combined with virus internalization assays comparing wild-type and RNASEK-depleted cells, would provide comprehensive insights into the structural basis of RNASEK's role in viral entry pathways .

How can RNA-seq analysis be optimized for studying RNASEK expression and its splice variants?

Optimizing RNA-seq analysis for RNASEK requires careful consideration of several technical aspects:

  • Sequencing depth: Higher depth may be necessary to detect subtle splice variants

  • Read length: Longer reads (≥100bp) improve detection of splice junctions

  • Paired-end sequencing: Provides better resolution of transcript isoforms compared to single-end

  • Biological replicates: Minimum 3-5 replicates for reliable statistical analysis

  • Specialized analysis tools: Algorithms designed for detecting subtle splice variants

The analysis pipeline should include rigorous quality control, appropriate read alignment optimized for splice junction detection, accurate assignment of reads to transcripts, and specific tools for quantifying alternative splicing events . For subtle splice variants like those in RNASEK, specialized algorithms may be required to detect differences of only a few nucleotides. Integration of RNA-seq data with other approaches (like the restriction enzyme-based methods) may provide the most comprehensive characterization of RNASEK transcript variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.