Recombinant Human RING finger and transmembrane domain-containing protein 2 (RNFT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RNFT2; TMEM118; RING finger and transmembrane domain-containing protein 2; Transmembrane protein 118
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNFT2
Target Protein Sequence
MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL YNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL CRSVAVDTLRCWKDGATSAHFQVY
Uniprot No.

Target Background

Database Links

HGNC: 25905

KEGG: hsa:84900

STRING: 9606.ENSP00000257575

UniGene: Hs.437195

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of RNFT2?

RNFT2 (ring finger protein, transmembrane 2) is a protein-coding gene that encodes a RING finger domain-containing protein with transmembrane properties. Like other RING finger proteins, it contains a cysteine-rich domain that coordinates zinc ions in a cross-brace formation, which is critical for its E3 ligase activity . The RING domain typically consists of an α-helix and three short-stranded β-sheets arranged near the zinc ions, creating a structure essential for protein-protein interactions and ubiquitination functions .

RNFT2 follows specific patterns of cysteine and histidine residues that create binding sites for zinc ions. This arrangement is fundamental to its function as an E3 ubiquitin ligase, allowing it to interact with target proteins and facilitate their ubiquitination .

How does RNFT2 differ from other RING finger proteins?

While RNFT2 shares structural similarities with other RING finger proteins, its distinguishing feature is its specific role in regulating IL-3 receptor α (IL-3Rα) stability and signaling . Unlike some RING proteins that target multiple substrates, RNFT2 appears to have a more specialized function in inflammatory regulation through the IL-3 signaling pathway .

Other RING finger proteins, such as COP1, MDM2, BARD1, and BRCA-1, target different substrates and function in various cellular processes including DNA repair, cell cycle regulation, and cancer development . RNFT2's transmembrane characteristic also differentiates it from many other RING finger proteins, suggesting its localization to cellular membranes, which is essential for accessing its target receptors .

What are the standard methods for expressing recombinant RNFT2?

For recombinant expression of human RNFT2, researchers typically clone the cDNA ORF sequence into expression vectors such as pcDNA3.1+/C-(K)DYK . The expression process involves:

  • Gene Synthesis or Cloning: The RNFT2 coding sequence (RefSeq: XM_020919102.1) can be synthesized or PCR-amplified from cDNA libraries.

  • Vector Selection: Standard mammalian expression vectors containing strong promoters (CMV) are recommended.

  • Cell Line Selection: HEK293 or CHO cells are commonly used for mammalian expression, while E. coli systems may be used for protein fragments without transmembrane domains.

  • Transfection Methods: Lipid-based transfection reagents for transient expression or stable cell line generation through antibiotic selection.

  • Protein Purification: Affinity tags (His, FLAG, or GST) facilitate purification through corresponding affinity chromatography .

When designing expression systems, researchers should account for RNFT2's transmembrane nature, which may require detergent-based extraction methods for solubilization.

How can researchers verify the functionality of recombinant RNFT2?

Functional verification of recombinant RNFT2 can be performed through several assays:

  • In vitro Ubiquitination Assay: This is the gold standard for confirming E3 ligase activity. A complete reaction requires purified RNFT2, E1 and E2 enzymes, ubiquitin, ATP, and substrate protein (e.g., IL-3Rα). Ubiquitination of the substrate is detected through Western blotting .

  • Protein-Protein Interaction Assays: Co-immunoprecipitation or pull-down assays can confirm RNFT2's interaction with its substrate IL-3Rα .

  • Substrate Degradation Assay: Overexpression of RNFT2 in cell lines should lead to decreased levels of IL-3Rα protein without affecting its mRNA expression, which can be monitored by Western blot and qRT-PCR, respectively .

  • Cellular Localization: Immunofluorescence microscopy to confirm proper membrane localization of the recombinant protein.

Functional RNFT2 will demonstrate E3 ligase activity, specifically targeting IL-3Rα for ubiquitination and subsequent degradation, as shown in published research .

What is the regulatory mechanism of RNFT2 in IL-3 signaling?

RNFT2 functions as a critical regulator of IL-3 signaling through a post-translational mechanism. The regulatory pathway involves:

  • Target Recognition: RNFT2 specifically associates with IL-3Rα, as demonstrated through pull-down experiments .

  • Ubiquitination Process: As an E3 ligase, RNFT2 facilitates the transfer of ubiquitin molecules to IL-3Rα, marking it for degradation. In vitro ubiquitination assays confirm that RNFT2, along with the complete ubiquitination machinery, is sufficient to ubiquitinate IL-3Rα .

  • Receptor Degradation: Ubiquitinated IL-3Rα undergoes proteasomal degradation, thereby reducing available receptors for IL-3 binding and subsequent signaling.

  • Signaling Outcome: By controlling IL-3Rα protein levels, RNFT2 regulates IL-3-induced signaling cascades that influence inflammatory responses and innate immunity .

This mechanism establishes RNFT2 as an inflammatory suppressor protein, as its expression leads to decreased IL-3 signaling, which may be therapeutically relevant in conditions with aberrant inflammation .

What are the challenges in studying RNFT2 protein-protein interactions?

Investigating RNFT2 protein-protein interactions presents several methodological challenges:

  • Transmembrane Nature: RNFT2's transmembrane domains complicate purification and in vitro interaction studies, requiring specialized detergent-based approaches that might affect protein conformation .

  • Transient Interactions: Like many E3 ligases, RNFT2's interactions with substrates may be transient, particularly during the ubiquitination process, making these interactions difficult to capture using standard techniques .

  • Complex Formation Detection: Distinguishing specific RNFT2-substrate complexes from non-specific binding requires careful control experiments and validation through multiple methods.

  • Physiological Relevance: Interactions detected in overexpression systems may not reflect physiological conditions, necessitating studies in relevant primary cells or tissues.

Researchers can address these challenges through:

  • Using proximity labeling approaches (BioID, APEX)

  • Employing catalytically inactive RNFT2 mutants to stabilize interactions

  • Utilizing crosslinking techniques prior to immunoprecipitation

  • Conducting studies in physiologically relevant cell types where IL-3 signaling is functionally important

How can researchers effectively measure RNFT2-mediated ubiquitination in vivo?

Measuring RNFT2-mediated ubiquitination in vivo requires specialized approaches to capture this transient post-translational modification. Effective methodologies include:

  • Tandem Ubiquitin Binding Entities (TUBEs): These ubiquitin-associated domain-containing proteins can be used to capture ubiquitinated proteins from cell lysates, followed by immunoblotting for IL-3Rα .

  • Immunoprecipitation Under Denaturing Conditions: This approach prevents deubiquitination by proteases during sample processing. Cells expressing HA-tagged ubiquitin and IL-3Rα can be lysed under denaturing conditions, followed by IL-3Rα immunoprecipitation and detection of ubiquitin chains .

  • In vivo Ubiquitination Assays: Co-expression of RNFT2, IL-3Rα, and tagged ubiquitin in cells, followed by proteasome inhibitor treatment (MG132) to allow accumulation of ubiquitinated species for detection .

  • Ubiquitin Chain-Specific Antibodies: Using antibodies recognizing specific ubiquitin linkages (K48, K63) to determine the type of ubiquitination catalyzed by RNFT2, providing insights into the degradation pathway.

  • Endogenous System Analysis: For physiologically relevant assessment, detecting ubiquitination of endogenous IL-3Rα in immune cells after modulating RNFT2 expression levels .

Control experiments should include RNFT2 catalytic mutants and deubiquitinase inhibitors to validate specificity.

What are the optimal conditions for biochemical characterization of RNFT2?

Optimal biochemical characterization of RNFT2 requires careful consideration of its transmembrane nature and E3 ligase activity. Recommended conditions include:

  • Protein Expression and Purification:

    • Expression System: Mammalian cells (HEK293 or CHO) for full-length protein; E. coli for isolated RING domain studies

    • Solubilization: Non-ionic detergents (0.5-1% DDM or CHAPS) for membrane extraction

    • Purification: Tandem affinity purification with His or FLAG tags followed by size exclusion chromatography

  • Buffer Conditions:

    • In vitro Activity Assays: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 2 mM ATP, 0.1-0.5 mM DTT

    • Zinc Supplementation: 10-50 μM ZnCl₂ to maintain RING domain structure

    • Detergent: Low concentrations (0.01-0.05%) of DDM or CHAPS for stability

  • E3 Ligase Activity Assays:

    • Temperature: 30°C (optimal for maintaining stability while allowing activity)

    • Incubation Time: 30-60 minutes for ubiquitination reactions

    • Components: Purified E1 (UBA1), E2 (UbcH5 family), ubiquitin, ATP, and substrate (IL-3Rα)

  • Stability Considerations:

    • Avoid freeze-thaw cycles

    • Store purified protein at -80°C in small aliquots with 10-15% glycerol

    • Include protease inhibitors in all buffers

These conditions maximize RNFT2 stability and activity while enabling reproducible biochemical characterization .

What cellular models are most appropriate for studying RNFT2 function?

The selection of cellular models for RNFT2 research should be guided by its role in IL-3 signaling and inflammatory regulation. Appropriate models include:

  • Immune Cell Lines:

    • THP-1 or U937 (monocytic leukemia cells): Express IL-3 receptors and relevant signaling machinery

    • BMMC (Bone marrow-derived mast cells): Highly responsive to IL-3 and appropriate for primary cell studies

    • MLE (Murine lung epithelial cells): Used in published RNFT2 studies

  • Primary Cells:

    • Human peripheral blood mononuclear cells (PBMCs): For translational relevance

    • Mouse bone marrow-derived dendritic cells: For in vivo validation studies

    • Alveolar macrophages: To study RNFT2 in lung inflammatory conditions

  • Genetic Modification Approaches:

    • CRISPR/Cas9 for RNFT2 knockout studies

    • Inducible expression systems for temporal control of RNFT2 expression

    • Knock-in of tagged RNFT2 for tracking endogenous protein

  • Experimental Considerations:

    • IL-3 stimulation conditions: Typically 10-20 ng/ml for 15-60 minutes

    • Inflammatory challenge models: LPS (100 ng/ml) or relevant cytokine stimulation

    • Ubiquitination detection: Proteasome inhibitors (MG132, 10 μM) for 2-6 hours

The cellular context should match the research question, with immune cells being particularly relevant for studying RNFT2's role in inflammatory processes and IL-3 signaling .

How can researchers design loss-of-function and gain-of-function experiments for RNFT2?

Effective functional studies of RNFT2 require well-designed genetic manipulation approaches:

Loss-of-Function Strategies:

  • CRISPR/Cas9 Knockout:

    • Design guide RNAs targeting early exons of RNFT2

    • Create single-cell clones and validate complete protein loss by Western blotting

    • Control for off-target effects with rescue experiments

  • RNA Interference:

    • Design siRNA or shRNA targeting RNFT2 mRNA with 2-3 independent sequences

    • Validate knockdown efficiency at both mRNA (qRT-PCR) and protein levels

    • Use non-targeting sequences as controls

  • Dominant-Negative Mutants:

    • Express catalytically inactive RNFT2 (mutations in RING domain) to compete with endogenous protein

    • Key mutations: substitutions of zinc-coordinating cysteine residues in the RING domain

Gain-of-Function Strategies:

  • Overexpression Systems:

    • Use inducible promoters (Tet-On/Off) for controlled expression

    • Include epitope tags (HA, FLAG) for detection without antibody limitations

    • Compare multiple expression levels to identify potential artifacts

  • Fusion Constructs:

    • Create RNFT2-fluorescent protein fusions for live-cell imaging

    • Develop activity-reporting constructs with split luciferase systems

Functional Readouts:

  • Primary Endpoints:

    • IL-3Rα protein levels by Western blot and flow cytometry

    • IL-3Rα ubiquitination status

    • Downstream signaling activation (phospho-JAK2, STAT5)

  • Secondary Endpoints:

    • Inflammatory cytokine production

    • Cell proliferation and survival in response to IL-3

    • In vivo inflammatory challenge responses

These approaches provide complementary evidence for RNFT2's function, with careful controls to ensure specificity and physiological relevance .

What approaches are recommended for studying RNFT2 in different tissue contexts?

Investigating RNFT2 across different tissues requires specialized approaches tailored to each context:

Tissue-Specific Expression Analysis:

  • Transcriptomic Profiling:

    • RNA-seq of various tissues to determine relative RNFT2 expression

    • Single-cell RNA-seq to identify cell types with highest RNFT2 expression

    • Compare normal vs. diseased tissues for altered expression patterns

  • Protein Detection:

    • Immunohistochemistry with validated antibodies

    • Tissue microarrays for comparative analysis across multiple tissues

    • Western blotting of tissue lysates with proper controls

Functional Studies in Tissue Context:

  • Conditional Knockout Models:

    • Tissue-specific Cre-loxP systems targeting RNFT2

    • Inducible systems for temporal control of gene deletion

    • Analysis of tissue-specific phenotypes following conditional deletion

  • Ex Vivo Tissue Studies:

    • Precision-cut tissue slices maintained in culture

    • Organoid systems from relevant tissues

    • Primary cell isolation from specific tissue niches

  • Disease Models:

    • Inflammatory disease models to assess RNFT2's role in pathology

    • Infection models to study innate immune function

    • Tissue-specific IL-3 challenge models

Translational Approaches:

  • Human Tissue Analysis:

    • Biobanked specimens with proper clinical annotation

    • Correlation of RNFT2 expression with disease parameters

    • Multi-omics integration (proteomics, transcriptomics, clinical data)

  • Comparative Studies:

    • Cross-species analysis of RNFT2 function in tissue homologs

    • Evolutionary conservation analysis of tissue-specific regulation

These approaches collectively provide a comprehensive understanding of RNFT2's role across different tissue contexts, with particular focus on tissues where IL-3 signaling plays significant roles in homeostasis or pathology .

How should researchers interpret contradictory findings regarding RNFT2 function?

When facing contradictory findings about RNFT2 function, researchers should systematically evaluate several factors:

  • Experimental Context Differences:

    • Cell type specificity: RNFT2 function may vary between immune and non-immune cells

    • Species differences: Human versus mouse RNFT2 may have evolved distinct functions

    • Activation state: Cellular activation status may influence RNFT2 activity

  • Methodological Considerations:

    • Overexpression artifacts: Non-physiological protein levels may cause off-target effects

    • Antibody specificity: Different antibodies may recognize distinct RNFT2 conformations or isoforms

    • Assay sensitivity: Various detection methods have different thresholds for identifying interactions

  • Analytical Framework:

    • Create a detailed comparison table of contradictory studies, noting key methodological differences

    • Conduct meta-analysis where applicable to identify patterns across studies

    • Design bridging experiments specifically addressing contradictions

  • Resolution Strategies:

    • Perform side-by-side comparisons using identical reagents and protocols

    • Collaborate with groups reporting conflicting results for joint validation

    • Use orthogonal approaches to verify key findings

    • Consider context-dependent models that might reconcile apparently contradictory results

When analyzing contradictions, researchers should distinguish between true biological complexity and technical artifacts, recognizing that RNFT2 may indeed have context-dependent functions as seen with other RING finger proteins .

What statistical approaches are most appropriate for RNFT2 functional studies?

Statistical analysis for RNFT2 functional studies should be tailored to the experimental design and data characteristics:

  • For Protein Interaction Studies:

    • Multiple replicates (n≥3) with biological, not just technical repeats

    • Paired statistical tests for before/after comparisons

    • Appropriate controls for non-specific binding

    • Quantification methods: band intensity ratios normalized to loading controls

  • For Ubiquitination Assays:

    • Dose-response experiments analyzed with non-linear regression

    • Time-course studies evaluated with repeated measures ANOVA

    • Comparison of ubiquitination patterns using densitometry with multiple band analysis

  • For Cell-Based Functional Assays:

    • Two-way ANOVA for experiments testing multiple variables (e.g., RNFT2 expression × IL-3 stimulation)

    • Mixed-effects models for experiments with repeated measures

    • Appropriate post-hoc tests with correction for multiple comparisons

  • For Omics Data Integration:

    • Pathway enrichment analysis for transcriptomic/proteomic changes

    • Network analysis to identify functional modules affected by RNFT2

    • Multiple testing correction (FDR) for genome/proteome-wide analyses

  • Statistical Reporting Standards:

    • Clear statement of sample sizes and replication strategy

    • Effect size reporting alongside p-values

    • Confidence intervals where appropriate

    • Power analysis for negative results

These approaches ensure robust statistical inference while accounting for the complex biology of RNFT2-mediated processes and potential sources of variability .

How can researchers effectively compare RNFT2 with other RING finger proteins?

Effective comparison of RNFT2 with other RING finger proteins requires a structured approach:

  • Structural Comparison:

    • Sequence alignment focusing on the RING domain

    • Homology modeling to predict structural similarities and differences

    • Analysis of key functional residues across RING finger proteins

  • Functional Comparison Framework:

    AspectRNFT2Other RING Proteins (e.g., MDM2, BRCA1)
    Substrate SpecificityIL-3Rα specificVaries (broad to specific)
    Cellular LocalizationTransmembraneNuclear, cytoplasmic, or membrane
    Regulatory MechanismsIL-3 signalingVarious (cell cycle, DNA repair)
    Ubiquitination TypeK48-linked (presumed)K48, K63, mixed chains
    Pathological RolesInflammatory regulationCancer, development, immunity
  • Experimental Approaches:

    • Domain swapping to identify functional determinants

    • Substrate specificity assays comparing multiple E3 ligases

    • Cross-complementation studies in knockout models

    • Competitive binding assays for E2 enzymes

  • Evolutionary Analysis:

    • Phylogenetic comparison across species

    • Identification of conserved vs. divergent regions

    • Analysis of positive selection signatures in functional domains

  • Regulatory Network Integration:

    • Comparison of transcriptional and post-translational regulation

    • Identification of shared regulatory pathways

    • Network analysis to position RNFT2 within RING finger protein functional networks

This multifaceted approach allows researchers to situate RNFT2 within the broader RING finger protein family while highlighting its unique characteristics and functions .

What are the key considerations when interpreting RNFT2 expression data across different tissues?

Interpreting RNFT2 expression patterns across tissues requires careful consideration of several factors:

  • Technical Considerations:

    • RNA vs. protein correlation: RNFT2 mRNA levels may not directly correlate with protein expression due to post-transcriptional regulation

    • Detection method sensitivity: Different methods have varying detection thresholds

    • Antibody validation: Confirm specificity using knockout controls

    • Subcellular localization: Consider whether extraction methods preserve membrane proteins

  • Biological Interpretation Framework:

    • Cell type heterogeneity: Bulk tissue data may mask cell-specific expression patterns

    • Developmental stage: Expression may vary throughout development

    • Pathological state: Disease conditions may alter expression patterns

    • Regulatory context: Co-expression with IL-3Rα and related signaling components

  • Comparative Analysis Approaches:

    • Normalization methods: Select appropriate reference genes or proteins for each tissue

    • Relative vs. absolute quantification: Consider the limitations of each approach

    • Multi-omics integration: Correlate expression with epigenetic data, proteomics, and functional outcomes

    • Cross-species comparison: Evaluate conservation of expression patterns

  • Functional Correlation Analysis:

    • Expression vs. activity: High expression may not indicate high functional activity

    • Isoform considerations: Different tissues may express different RNFT2 isoforms

    • Regulatory network context: Consider expression of interaction partners and regulators

    • Phenotypic correlation: Relate expression levels to tissue-specific functions or pathologies

These considerations help researchers move beyond simple quantification to biologically meaningful interpretation of RNFT2 expression data, particularly in relation to its role in IL-3 signaling and inflammatory regulation .

What is the potential role of RNFT2 in inflammatory and autoimmune diseases?

RNFT2's function as an inflammatory suppressor protein through IL-3 signaling regulation suggests significant implications for inflammatory and autoimmune conditions:

  • Mechanistic Basis:

    • RNFT2 negatively regulates IL-3Rα levels through ubiquitination and degradation

    • IL-3 signaling promotes various inflammatory processes including cytokine production and immune cell activation

    • Dysregulation of this pathway could contribute to pathological inflammation

  • Disease Relevance:

    • Allergic Inflammation: IL-3 is central to allergic responses, suggesting RNFT2 may regulate severity of allergic conditions

    • Autoimmune Disorders: Aberrant IL-3 signaling contributes to autoimmune pathology

    • Inflammatory Lung Diseases: RNFT2's expression in lung epithelial cells suggests potential relevance to conditions like asthma and COPD

  • Therapeutic Implications:

    • Target Modulation: Enhancing RNFT2 expression or activity might dampen excessive IL-3 signaling

    • Pathway Specificity: RNFT2 targeting offers receptor-specific modulation versus broader IL-3 inhibition

    • Biomarker Potential: RNFT2 expression levels or activity could indicate inflammatory disease activity

  • Research Approaches:

    • Analysis of RNFT2 expression in tissue samples from patients with inflammatory diseases

    • Genetic association studies examining RNFT2 variants and disease susceptibility

    • Animal models with RNFT2 deletion or overexpression challenged with inflammatory stimuli

    • Ex vivo studies with patient-derived cells assessing RNFT2 function

The RNFT2/IL-3Rα axis represents a promising target for interventions in inflammatory conditions where IL-3 signaling contributes to pathology .

How might RNFT2 dysfunction contribute to pathological conditions?

RNFT2 dysfunction could contribute to various pathological conditions through several mechanisms:

  • Loss of Function Scenarios:

    • Reduced E3 Ligase Activity: Mutations affecting the RING domain could impair ubiquitination capacity

    • Impaired Substrate Recognition: Altered binding domains might prevent IL-3Rα recognition

    • Mislocalization: Defects in transmembrane domains could affect subcellular positioning

    • Expression Deficits: Transcriptional/translational dysregulation might reduce RNFT2 levels

  • Potential Pathological Consequences:

    • Hyperactive IL-3 Signaling: Reduced IL-3Rα degradation leading to increased receptor density and signaling

    • Enhanced Inflammatory Responses: Exaggerated cytokine production and immune cell activation

    • Altered Cell Proliferation: IL-3's role in cell proliferation suggests potential involvement in hyperplastic conditions

    • Immune Dysregulation: Disrupted balance between inflammatory and anti-inflammatory processes

  • Specific Disease Associations:

    • Inflammatory Disorders: Conditions characterized by excessive inflammatory responses

    • Myeloproliferative Disorders: Given IL-3's role in hematopoiesis

    • Allergic Conditions: Due to IL-3's importance in mast cell biology

    • Potential Cancer Relevance: Dysregulated E3 ligases frequently contribute to oncogenesis

  • Assessment Approaches:

    • Functional characterization of RNFT2 variants identified in patient populations

    • Correlation of RNFT2 expression/activity with disease severity markers

    • Tissue-specific knockout models examining pathological consequences

    • Rescue experiments reinstating wild-type RNFT2 in dysfunction models

Understanding RNFT2 dysfunction provides insights into pathological mechanisms and potential therapeutic opportunities in conditions involving dysregulated IL-3 signaling and inflammatory responses .

What experimental approaches can assess RNFT2 as a therapeutic target?

Evaluating RNFT2 as a therapeutic target requires a comprehensive validation strategy:

  • Target Validation Approaches:

    • Genetic Validation:

      • CRISPR/Cas9 knockout in disease models

      • Inducible expression systems to modulate RNFT2 levels in established disease

      • Patient-derived cells with RNFT2 variants

    • Pharmacological Validation:

      • Small molecule screens for RNFT2 activity modulators

      • Structure-based drug design targeting the RING domain

      • Peptide inhibitors disrupting RNFT2-IL-3Rα interaction

  • Therapeutic Modality Assessment:

    ApproachAdvantagesChallengesEvaluation Methods
    Activity EnhancementSpecificity for IL-3 pathwayDelivery to target tissuesIn vitro ubiquitination assays, cellular IL-3Rα levels
    Expression ModulationPhysiological regulationOff-target effectsqRT-PCR, Western blot, reporter assays
    Protein-Protein Interaction DisruptionPathway specificityDesigning effective inhibitorsFRET/BRET assays, co-IP, AlphaScreen
    Stability ModulationPost-translational approachComplex regulatory mechanismsPulse-chase, cycloheximide chase
  • Disease-Relevant Models:

    • Inflammatory challenge models with RNFT2 modulation

    • Ex vivo patient sample treatment with RNFT2-targeting compounds

    • Humanized mouse models for translational validation

    • Tissue-specific delivery systems for targeted intervention

  • Translational Biomarkers:

    • IL-3Rα surface expression as target engagement marker

    • Downstream signaling molecules (phospho-STAT5, JAK2)

    • Inflammatory cytokine profiles as functional readouts

    • Tissue-specific pathology scores in disease models

These approaches provide a framework for systematic evaluation of RNFT2 as a therapeutic target, particularly in inflammatory conditions where modulating IL-3 signaling could offer clinical benefit .

How can researchers develop assays to screen for modulators of RNFT2 activity?

Developing robust screening assays for RNFT2 modulators requires specialized approaches addressing its unique properties:

  • Primary Screening Assays:

    • Cell-Based Reporter Systems:

      • IL-3Rα-luciferase fusion constructs to monitor degradation

      • FRET-based sensors detecting RNFT2-IL-3Rα interaction

      • Split-luciferase complementation for protein-protein interaction screening

      • High-content imaging assays monitoring IL-3Rα levels and localization

    • Biochemical Assays:

      • In vitro ubiquitination assays with purified components

      • AlphaScreen/AlphaLISA for detecting RNFT2-substrate interactions

      • Fluorescence polarization assays with labeled peptide substrates

      • TR-FRET assays for E2-RNFT2 interaction

  • Assay Development Considerations:

    • Assay Parameters:

      • Z' factor optimization (target >0.5 for HTS)

      • Signal-to-background ratio optimization

      • Miniaturization for 384/1536-well formats

      • DMSO tolerance assessment

    • Controls:

      • Positive controls: Catalytically inactive RNFT2 mutants

      • Negative controls: Non-binding substrate variants

      • Reference inhibitors: General E3 ligase inhibitors as benchmarks

  • Secondary Validation Assays:

    • Target Engagement:

      • Cellular thermal shift assay (CETSA)

      • Microscale thermophoresis for binding affinity

      • Surface plasmon resonance for direct binding kinetics

    • Functional Validation:

      • IL-3Rα protein levels by Western blot

      • IL-3-induced STAT5 phosphorylation

      • Inflammatory cytokine production in relevant cell types

  • Screening Implementation:

    • Compound Libraries:

      • Focused libraries targeting E3 ligases

      • Natural product collections

      • Fragment-based libraries for initial hits

      • Repurposing libraries for accelerated development

    • Analysis Approaches:

      • Dose-response curves (8-12 points)

      • Structure-activity relationship studies

      • Machine learning for hit prediction and optimization

These comprehensive screening approaches enable systematic identification of compounds that modulate RNFT2 activity, providing starting points for therapeutic development targeting the RNFT2/IL-3Rα regulatory axis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.