Recombinant Human RING finger protein 122 (RNF122)

Shipped with Ice Packs
In Stock

Description

Immune Regulation

RNF122 suppresses antiviral innate immunity by targeting retinoic acid-inducible gene 1 (RIG-I):

  • Induces K48-linked ubiquitination of RIG-I at lysine residues 115 and 146, triggering proteasomal degradation .

  • Acts as a feedback inhibitor to prevent excessive type I interferon (IFN-β/α) production during RNA virus infections (e.g., VSV, Sendai virus) .

  • Deficiency in RNF122 enhances antiviral responses and improves survival in RNA virus-infected mice .

Cancer Progression

RNF122 promotes glioblastoma (GBM) growth via the JAK2/STAT3/c-Myc pathway:

  • Overexpressed in high-grade gliomas, correlating with poor patient prognosis .

  • Drives tumor proliferation and invasion by activating STAT3 phosphorylation and upregulating oncogenes like c-Myc .

  • Knockdown reduces GBM cell viability by inducing S-phase cell cycle arrest .

Key Research Findings

Study FocusMechanismImpactReference
Antiviral Immune ResponseRNF122 ubiquitinates RIG-I, leading to degradation and suppressed IFN production.Identified as a checkpoint for immune homeostasis.
Glioblastoma PathogenesisRNF122 activates JAK2/STAT3 signaling, enhancing tumor growth and metastasis.Proposed as a therapeutic target for GBM.
Protein InteractionsBinds DDX58/RIG-I, TRIM25, and RNF125; mediates K48 ubiquitination.Highlights RNF122’s role in ubiquitin-proteasome system regulation.

Recombinant RNF122 in Experimental Models

While explicit protocols for recombinant RNF122 production are not detailed in available literature, studies imply its use through:

  • Overexpression vectors: To analyze RNF122’s E3 ligase activity and substrate interactions .

  • siRNA knockdown: Validates functional roles in immune cells and cancer models .

  • Ubiquitination assays: Demonstrates self-ubiquitination and proteasomal degradation in HEK293T cells .

Clinical Implications

  • Cancer Therapy: Targeting RNF122 could inhibit JAK2/STAT3 signaling in glioblastoma .

  • Immune Modulation: Enhancing RNF122 activity might mitigate autoimmune disorders caused by excessive interferon production .

Research Gaps and Future Directions

  • Structural studies to resolve how RNF122’s TM and RING domains coordinate substrate ubiquitination.

  • Development of small-molecule inhibitors targeting RNF122 for glioblastoma treatment.

  • Role in neurodevelopmental disorders (e.g., ADHD) suggested by GWAS data requires validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
RNF122; RING finger protein 122
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF122
Target Protein Sequence
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL VKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
Uniprot No.

Target Background

Function

RNF122 may induce necrosis and apoptosis and potentially plays a role in regulating cell viability.

Database Links

HGNC: 21147

KEGG: hsa:79845

STRING: 9606.ENSP00000256257

UniGene: Hs.151237

Subcellular Location
Golgi apparatus. Endoplasmic reticulum. Membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed in several tissues and cell lines.

Q&A

What is RNF122 and what is its primary function in cellular processes?

RNF122 (RING finger protein 122) is an E3 ubiquitin ligase that contains a RING finger domain in its C-terminus and a transmembrane domain in its N-terminus. It plays crucial roles in various cellular processes including:

  • Protein degradation through the ubiquitin-proteasome system

  • Cell cycle regulation and cellular viability

  • Immune response modulation

  • Signal transduction pathway regulation

As demonstrated in biochemical characterization studies, RNF122 promotes the ubiquitination of target proteins and can also undergo self-ubiquitination, leading to its own degradation in a RING finger-dependent manner . The protein is primarily localized to the endoplasmic reticulum and Golgi apparatus .

What experimental methods are commonly used to study RNF122 expression?

Several methodological approaches are employed to study RNF122 expression:

MethodApplicationKey Considerations
qRT-PCRmRNA expression quantificationUses GAPDH as reference gene; requires proper primer design
Western Blot (WB)Protein expression analysisCan detect post-translational modifications
Immunohistochemistry (IHC)Tissue localizationUseful for patient samples and animal models
Flow CytometryCell cycle analysisUsed to assess RNF122's impact on cell cycle progression
Immunofluorescence (IF)Subcellular localizationCan be combined with proliferation markers (e.g., Ki-67)

When analyzing expression data, researchers should account for batch effects using normalization techniques, linear regression models, ComBat methods, or mixed models to ensure accurate and reliable statistical analysis .

How does RNF122 contribute to glioblastoma progression through the JAK2/STAT3/c-Myc pathway?

RNF122 has been identified as a significant contributor to glioblastoma (GBM) progression through the JAK2/STAT3/c-Myc signaling axis. The mechanistic pathway involves:

  • K63-linked ubiquitination of JAK2: RNF122 catalyzes non-degradative K63-linked ubiquitination of JAK2, which promotes its phosphorylation and activation .

  • Downstream STAT3 activation: Phosphorylated JAK2 activates STAT3 through phosphorylation .

  • Nuclear translocation and c-Myc upregulation: Phosphorylated STAT3 enters the nucleus and promotes the transcriptional activation of c-Myc .

  • Tumor progression: Elevated c-Myc levels drive GBM cell proliferation and cell cycle progression .

Experimental validation of this pathway included:

  • Overexpression and knockdown studies in LN-229 and A-172 GBM cell lines

  • Colony formation assays to assess proliferation

  • Flow cytometric analysis for cell cycle assessment

  • In vivo tumor growth experiments with Ki-67 staining

  • Cignal Finder Cancer 10-Pathway Reporter array to identify involved signaling pathways

  • Western blot analysis of pathway components (JAK1/2, STAT1/2/3, c-Myc and their phosphorylated forms)

Importantly, treatment with the JAK2/STAT3 inhibitor WP1066 (6 μM, 48h) attenuated the pro-tumorigenic effects of RNF122 overexpression, confirming the pathway's involvement .

What is the mechanism by which RNF122 regulates antiviral immune responses?

RNF122 functions as a selective negative regulator of antiviral innate immunity through a specific mechanism targeting the RIG-I pathway:

  • Direct interaction with RIG-I: The transmembrane domain of RNF122 associates with the caspase activation and recruitment domains (CARDs) of RIG-I, a cytoplasmic innate sensor for viral RNA .

  • K48-linked ubiquitination: This interaction enables the RING finger domain of RNF122 to deliver K48-linked ubiquitin chains specifically to lysine residues K115 and K146 of RIG-I CARDs .

  • Proteasomal degradation: The K48-linked ubiquitination promotes RIG-I degradation via the proteasome, resulting in marked inhibition of RIG-I downstream signaling .

  • Reduced type I IFN production: The degradation of RIG-I leads to suppressed production of type I interferons and proinflammatory cytokines, critical components of antiviral defense .

This regulatory mechanism was established through:

  • Mass spectrometry screening of RIG-I-interacting proteins in RNA virus-infected cells

  • Domain mapping studies to identify interaction regions

  • Ubiquitination assays to determine the type of ubiquitin linkage

  • Functional studies in RNF122-deficient mice and cells

RNF122-deficient mice exhibit increased resistance against lethal RNA virus infection with enhanced production of type I IFNs, demonstrating the physiological relevance of this regulatory pathway .

How can researchers effectively produce and validate recombinant RNF122 for experimental applications?

Production and validation of recombinant RNF122 require specific methodological considerations:

Production Methods:

  • Expression System Selection: HEK293T cells are commonly used for RNF122 expression as they maintain proper post-translational modifications and protein folding .

  • Vector Design: Constructs should include:

    • Full-length RNF122 cDNA (435bp for some species)

    • Appropriate tags (e.g., DYKDDDDK/FLAG) for detection and purification

    • Strong promoters (e.g., CMV) for efficient expression

Validation Approaches:

  • Purity Assessment:

    • SDS-PAGE with Coomassie blue staining (>80% purity recommended)

    • Western blot analysis with anti-RNF122 or anti-tag antibodies

  • Functional Validation:

    • In vitro ubiquitination assays to confirm E3 ligase activity

    • Interaction studies with known binding partners (e.g., CAML)

    • Cell-based assays to verify biological activity (e.g., effects on JAK/STAT signaling)

  • Quality Control Parameters:

    • Concentration determination using microplate BCA method (target >50 μg/mL)

    • Endotoxin testing for in vivo applications

    • Stability testing under various storage conditions

Important Considerations:

  • Include both wild-type RNF122 and RING domain mutants as controls to confirm the specificity of E3 ligase activity

  • For studies involving JAK2/STAT3 pathway, validate the recombinant protein's ability to affect pathway activation in reporter assays

  • When studying interactions with RIG-I, confirm binding using co-immunoprecipitation assays

What are the implications of RNF122 dysregulation in neurological disorders such as ADHD?

Research has identified RNF122 as a potential contributor to neurological disorders, particularly ADHD (Attention Deficit Hyperactivity Disorder):

  • Genetic Association: Gene-wide association studies revealed preliminary evidence for genetic association between RNF122 and ADHD .

  • Expression Alterations: RNF122 was found to be significantly overexpressed in peripheral blood mononucleated cells (PBMCs) of medication-naive adults with ADHD compared to healthy controls .

  • Potential Mechanisms in ADHD:

    • Dysregulation of the ubiquitin-proteasome system (UPS), which is critical for protein turnover and synaptic plasticity in neurons

    • Altered protein trafficking and degradation affecting neurotransmitter systems

    • Potential impact on cell cycle regulation in neural development

  • Methodological Approaches Used:

    • Gene expression validation through RT-qPCR in clinical samples (45 ADHD cases, 39 controls)

    • Genotype imputation using SHAPEIT and IMPUTE2 with data from the 1000 Genomes Project

    • Association analysis using logistic regression models

    • Multiple-testing correction (Bonferroni and SNPSpD)

    • eQTL analysis using neurologically normal human brain samples

The evidence suggests that RNF122, through its role in the ubiquitin-proteasome system, may represent a promising candidate for involvement in the etiology of ADHD . Future research should explore the specific neurobiological pathways through which RNF122 dysregulation might contribute to ADHD pathophysiology.

How does the interaction between RNF122 and CAML affect RNF122's stability and function?

The interaction between RNF122 and calcium-modulating cyclophilin ligand (CAML) represents an important regulatory mechanism:

  • Identification of Interaction: CAML was identified as an RNF122-interacting protein through yeast two-hybrid screening .

  • Validation of Interaction:

    • Co-immunoprecipitation experiments confirmed the physical interaction

    • Colocalization studies in intact cells demonstrated spatial proximity

    • Domain mapping revealed the specific regions involved in the interaction

  • Functional Relationship:

    • CAML is not a substrate for RNF122's ubiquitin ligase activity

    • Instead, CAML acts to stabilize RNF122 protein levels

    • This represents a non-catalytic regulatory mechanism for an E3 ligase

  • Cellular Implications:

    • The interaction may serve as a regulatory mechanism to control RNF122's availability and activity

    • CAML-mediated stabilization could counterbalance RNF122's self-ubiquitination and degradation

    • The interaction potentially links RNF122 function to calcium signaling pathways

This interaction provides insight into how E3 ubiquitin ligases like RNF122 are themselves regulated post-translationally through protein-protein interactions rather than enzymatic modifications .

What are effective experimental designs to study RNF122's role in signaling pathways?

To effectively investigate RNF122's role in signaling pathways, researchers should consider the following experimental design approaches:

1. Loss and Gain of Function Studies:

  • siRNA/shRNA Knockdown: Use validated sequences with significant knockdown impact (>70% reduction)

  • CRISPR-Cas9 Gene Editing: For complete knockout studies

  • Overexpression Systems: Employ lentiviral vectors with puromycin selection for stable expression

  • Rescue Experiments: Combine knockdown with re-expression to confirm specificity

2. Pathway Analysis Tools:

  • Cignal Finder Cancer 10-Pathway Reporter Arrays: To screen potential signaling pathways (as used in RNF122-JAK/STAT studies)

  • Gene Set Enrichment Analysis (GSEA): To identify correlated pathways

  • Western Blot Panels: Include both total and phosphorylated forms of pathway components (JAK1/2, STAT1/2/3, etc.)

3. Validation in Multiple Models:

  • Cell Lines: Use multiple relevant cell lines (e.g., LN-229 and A-172 for GBM studies)

  • Primary Cells: Include patient-derived or normal cells when possible

  • Animal Models: For in vivo validation of findings

  • Patient Samples: Compare expression in normal vs. disease tissues

4. Functional Readouts:

  • Colony Formation Assays: For proliferation assessment

  • Flow Cytometry: For cell cycle analysis

  • Migration/Invasion Assays: For metastatic potential

  • Luciferase Reporter Assays: For pathway activation measurement

5. Pharmacological Validation:

  • Pathway Inhibitors: Use specific inhibitors (e.g., WP1066 for JAK/STAT)

  • Proteasome Inhibitors: To confirm ubiquitination-mediated degradation

  • Dose-Response and Time-Course Studies: To establish temporal dynamics

When designing these experiments, researchers should incorporate appropriate controls, account for batch effects, and perform proper statistical analyses including normality testing and suitable statistical models (t-tests, ANOVA with Dunnett's test, etc.) .

What techniques are most suitable for identifying novel interaction partners and substrates of RNF122?

Identifying novel interaction partners and substrates of RNF122 requires specialized techniques:

1. Protein-Protein Interaction Discovery:

  • Mass Spectrometry-Based Approaches:

    • Immunoprecipitation followed by LC-MS/MS (as used in RIG-I interaction studies)

    • BioID or APEX proximity labeling to capture transient interactions

    • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) for quantitative interactomics

  • Yeast Two-Hybrid Screening:

    • Successfully used to identify CAML as an RNF122 interacting protein

    • Can use different domains of RNF122 as bait to map domain-specific interactions

2. Substrate Identification Strategies:

  • Global Ubiquitinome Analysis:

    • Ubiquitin remnant profiling using di-glycine antibodies

    • Compare ubiquitination patterns in RNF122 knockdown/knockout vs. control cells

  • Candidate-Based Approaches:

    • In vitro ubiquitination assays with recombinant proteins

    • Ubiquitination site mapping using mass spectrometry (as performed for K115 and K146 in RIG-I)

3. Validation Methods:

  • Co-immunoprecipitation: To confirm physical interactions between RNF122 and potential partners

  • Colocalization Studies: Using fluorescently tagged proteins to visualize proximity in cells

  • Domain Mapping: Using truncation mutants to identify specific interaction regions

    • Transmembrane domain of RNF122 was shown to interact with CARDs of RIG-I

  • Functional Assays: To determine biological consequences of the interaction

4. Linkage-Specific Ubiquitination Analysis:

  • Ubiquitin Mutants: K48R, K63R, etc. to determine ubiquitin chain types

  • Linkage-Specific Antibodies: To distinguish between K48 (degradative) and K63 (non-degradative) ubiquitination

  • Mass Spectrometry: To identify precise ubiquitination sites and linkage types

5. Computational Approaches:

  • Prediction Algorithms: UbPred, UbiSite for substrate prediction

  • Structural Modeling: To predict binding interfaces

  • Network Analysis: To identify functional connections in existing datasets

These complementary approaches have proven effective in characterizing RNF122's interactions with RIG-I in immune regulation and with components of the JAK2/STAT3 pathway in glioblastoma .

How can researchers effectively analyze the impact of RNF122 mutations or variants on its function?

To analyze how mutations or variants affect RNF122 function, researchers should implement a comprehensive analysis framework:

1. Mutation/Variant Identification and Selection:

  • Database Mining: Extract RNF122 variants from TCGA, gnomAD, COSMIC, or disease-specific databases

  • Patient Sequencing: Identify disease-associated variants

  • Structural Knowledge-Based Design: Create mutations in key domains:

    • RING finger domain (E3 ligase activity)

    • Transmembrane domain (localization and protein interaction)

    • Potential phosphorylation or other PTM sites

2. Functional Impact Assessment:

  • E3 Ligase Activity Assays:

    • In vitro ubiquitination assays with recombinant proteins

    • Cell-based ubiquitination assays for targets like RIG-I

    • Self-ubiquitination assays (as RNF122 promotes its own degradation)

  • Protein Stability Analysis:

    • Cycloheximide chase assays to measure protein half-life

    • Proteasome inhibition studies with MG132 or bortezomib

    • Quantification of steady-state levels by western blotting

  • Subcellular Localization:

    • Immunofluorescence microscopy with organelle-specific markers

    • Subcellular fractionation followed by western blotting

    • Live-cell imaging with fluorescently tagged RNF122 variants

3. Signaling Pathway Analysis:

  • JAK2/STAT3 Pathway Assessment:

    • Western blot analysis of pathway components (p-JAK2, p-STAT3, c-Myc)

    • Luciferase reporter assays for pathway activation

    • qRT-PCR for target gene expression

  • Antiviral Response Measurement:

    • Type I interferon production assays

    • RIG-I pathway activation in response to viral RNA

    • Viral replication assays in cells expressing RNF122 variants

4. Structure-Function Relationship Studies:

  • Domain Deletion/Swapping Experiments: To map functional regions

  • Point Mutation Analysis: Targeting conserved residues in the RING domain

  • Molecular Modeling: To predict impact of mutations on protein structure

5. Physiological Impact:

  • Cell-Based Phenotypic Assays:

    • Proliferation (for GBM-related function)

    • Cell cycle analysis by flow cytometry

    • Migration and invasion assays

  • In Vivo Models:

    • Transgenic expression of RNF122 variants

    • Assessment of tumor growth (for oncogenic variants)

    • Virus challenge models (for immune function variants)

Each mutation/variant should be systematically characterized through this pipeline, with appropriate wild-type and negative controls, to establish clear genotype-phenotype correlations for RNF122.

What are the potential therapeutic applications of targeting RNF122 in glioblastoma treatment?

Based on current research, targeting RNF122 in glioblastoma (GBM) presents several therapeutic opportunities:

1. Rationale for RNF122 as a GBM Target:

  • Overexpression Pattern: RNF122 is significantly upregulated in GBM compared to normal brain tissues (NBT) and its expression correlates with tumor grade

  • Prognostic Value: High RNF122 expression is associated with poor clinical outcomes and serves as an independent prognostic factor

  • Functional Role: RNF122 promotes GBM cell proliferation, migration, invasion, and cell cycle progression

  • Pathway Activation: RNF122 activates the oncogenic JAK2/STAT3/c-Myc pathway through K63-linked ubiquitination of JAK2

2. Potential Therapeutic Strategies:

ApproachMechanismAdvantagesChallenges
RNF122 knockdownDirect reduction of RNF122 levels using siRNA/shRNASpecific targeting, demonstrated efficacy in preclinical modelsDelivery across blood-brain barrier
RING domain inhibitorsSmall molecules targeting E3 ligase activityMay be more druggable than protein-protein interactionsPotential off-target effects on other RING E3 ligases
JAK2/STAT3 pathway inhibitorsBlock downstream effects (e.g., WP1066)Already in development for other cancers, demonstrated efficacy in RNF122-overexpressing cells Pathway redundancy, resistance mechanisms
Protein-protein interaction disruptorsPrevent RNF122-JAK2 interactionHigh specificity potentialChallenging drug development target
Degrader approaches (PROTACs)Induced degradation of RNF122Catalytic mechanism requiring lower drug concentrationsComplex design requirements

3. Combination Therapy Potential:

  • Synergy with Standard GBM Treatments: Combining RNF122 inhibition with temozolomide, radiation therapy, or surgical resection

  • Dual Pathway Inhibition: Simultaneously targeting RNF122 and other oncogenic pathways

  • Immunotherapy Enhancement: Exploiting RNF122's role in immune regulation to improve immunotherapy responses

4. Biomarker Applications:

  • Patient Stratification: Using RNF122 expression levels to identify patients likely to benefit from targeted therapies

  • Treatment Response Monitoring: Measuring changes in RNF122 levels or activity during treatment

  • Resistance Mechanisms: Identifying alterations in RNF122 pathway as potential resistance biomarkers

Research indicates that RNF122 could be an effective therapeutic target, as demonstrated by decreased tumor growth following RNF122 knockdown in preclinical models . The efficacy of JAK2/STAT3 inhibitors in counteracting RNF122 overexpression effects further supports the translational potential of this pathway .

How might understanding RNF122's role in immune regulation inform antiviral therapeutic development?

RNF122's established role in immune regulation offers insights for antiviral therapeutic development:

1. Mechanistic Basis for Therapeutic Development:

  • RNF122 negatively regulates antiviral responses by promoting K48-linked ubiquitination and degradation of RIG-I

  • RNF122-deficient mice exhibit enhanced resistance to RNA virus infection with increased type I interferon production

  • RNF122 expression is upregulated by innate immune stimuli, functioning as a feedback regulator

2. Therapeutic Approaches Based on RNF122 Biology:

ApproachMechanismPotential ApplicationsResearch Considerations
RNF122 inhibitionPrevent RIG-I degradation to enhance antiviral immunityBroad-spectrum antiviral therapy, vaccine adjuvantPotential for excessive inflammation, autoimmunity
Transient RNF122 knockdownTemporally enhance antiviral responsesTreatment of acute viral infectionsDelivery systems, timing optimization
RNF122-RIG-I interaction blockersPrevent binding to CARDs of RIG-ISelective enhancement of RIG-I pathwayStructure-based drug design needed
Targeted modulation of K48 vs. K63 ubiquitinationShift from degradative to activating ubiquitinationFine-tuning of immune responseRequires linkage-specific targeting

3. Methodological Approaches for Therapeutic Development:

  • Target Validation:

    • Confirming RNF122-RIG-I pathway in human cells and tissues

    • Evaluating impact across different virus families

    • Determining tissue-specific effects given RNF122's preferential expression in macrophages

  • Assay Development:

    • In vitro ubiquitination assays to screen RNF122 inhibitors

    • Reporter systems for RIG-I pathway activation

    • Viral replication assays in relevant cell types

    • Type I interferon production measurement

  • Preclinical Models:

    • RNF122-deficient mice for proof-of-concept studies

    • Humanized mouse models for translational validation

    • Viral challenge models with RNA viruses

4. Considerations for Clinical Applications:

  • Temporal Considerations: Short-term inhibition may be beneficial while long-term suppression might have adverse effects

  • Cell Type Specificity: Targeting macrophage-specific RNF122 functions

  • Combination Approaches: Integrating with existing antivirals or immune modulators

  • Biomarker Development: Using RNF122 levels or activity as indicators of immune status

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.