Recombinant Human RING finger protein 170 (RNF170)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RNF170; E3 ubiquitin-protein ligase RNF170; Putative LAG1-interacting protein; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF170
Target Protein Sequence
MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELV RVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTL LRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLL LIYISIMYREVITQRLTR
Uniprot No.

Target Background

Function
RNF170 is an E3 ubiquitin-protein ligase crucial for stimulus-induced ubiquitination and degradation of inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) via the endoplasmic reticulum-associated degradation (ERAD) pathway. It also participates in ITPR1 turnover under resting conditions.
Gene References Into Functions
  1. Aberrant substrate ubiquitination or cellular adaptation to chronically reduced RNF170 levels may explain the autosomal dominant sensory ataxia-associated Ca2+ signaling deficit. PMID: 25882839
  2. RNF170 plays a vital role in IP3 receptor processing through the ubiquitin-proteasome pathway. PMID: 21610068
  3. These findings suggest that RNF170 mutations cause sensory ataxia. PMID: 21115467
Database Links

HGNC: 25358

OMIM: 608984

KEGG: hsa:81790

STRING: 9606.ENSP00000434797

UniGene: Hs.491626

Involvement In Disease
Ataxia, sensory, 1, autosomal dominant (SNAX1)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the spinal chord.

Q&A

Basic Research Questions

  • What is RNF170 and what is its primary function in cellular contexts?

RNF170 is an endoplasmic reticulum (ER) membrane ubiquitin ligase that plays a critical role in the regulation of inositol 1,4,5-trisphosphate (IP3) receptor signaling. It functions primarily to facilitate the ubiquitination of activated IP3 receptors, targeting them for degradation via the ubiquitin-proteasome pathway. Structurally, RNF170 contains a canonical RING-HC domain essential for its ubiquitin ligase activity and has three transmembrane domains that anchor it to the ER membrane. This approximately 257 amino acid protein has a predicted molecular mass of ~30 kDa, though it typically migrates at ~21.5 kDa in SDS-PAGE, possibly due to post-translational modifications or maintained protein folding during electrophoresis .

RNF170 is highly conserved across vertebrates, highlighting its evolutionary importance. Studies using CRISPR/Cas9-mediated genetic deletion have demonstrated that RNF170 mediates the addition of all known ubiquitin conjugates (monoubiquitin and Lys48- and Lys63-linked ubiquitin chains) to activated IP3 receptors . This comprehensive ubiquitination pattern is essential for proper regulation of calcium signaling via IP3 receptors.

  • What experimental methods are most effective for studying RNF170 membrane topology and localization?

Several complementary experimental approaches have proven effective for studying RNF170 topology and localization:

Glycosylation Tagging Analysis

The most definitive method involves creating a series of truncation mutants with C-terminal HA/glycosylation tags and assessing their sensitivity to the deglycosylating activity of endo H. This approach provides detailed information on protein orientation across the ER membrane .

For example, experimental evidence confirmed that:

  • Full-length RNF170 (N267RNF170-HA) is insensitive to endo H (not glycosylated), localizing its C-terminus to the cytosol

  • N230RNF170-HA is sensitive to endo H, indicating its C-terminus is glycosylated within the ER lumen

  • N200RNF170-HA is insensitive to endo H, confirming the orientation of TM2

N-terminal Glycosylation Analysis

To confirm N-terminal orientation, researchers can create constructs with engineered N-glycosylation consensus sequences (e.g., G8NRNF170-FLAG, which replaces Gly8 with asparagine to create an NQS motif). Partial glycosylation of this construct indicates that the N-terminus is located in the ER lumen .

Fluorescent Protein Tagging

For live-cell visualization, RNF170 can be tagged with fluorescent proteins and co-localized with known ER markers using confocal microscopy.

Subcellular Fractionation

Differential centrifugation followed by Western blotting can biochemically confirm RNF170's enrichment in ER membrane fractions.

The combined results of these methods have established that RNF170 resides in the ER membrane with its N-terminus in the ER lumen and with the RING domain and C-terminus in the cytosol .

  • How do researchers produce and purify recombinant RNF170 for functional studies?

Producing functional recombinant RNF170 presents unique challenges due to its multiple transmembrane domains. Several effective production strategies have been developed:

Wheat Germ Expression System

In vitro wheat germ expression systems preserve correct conformational folding necessary for biological function. Commercial recombinant human RNF170 is typically produced as an N-terminal GST-tagged protein corresponding to amino acids 1-200 of the human sequence .

Mammalian Expression Systems

For laboratory-scale production of functional protein:

  • The RNF170 coding sequence is amplified from mRNA using RT-PCR

  • The amplified sequence is cloned into mammalian expression vectors (e.g., pcDNA3 or pCMV14-3xFLAG)

  • Tagged versions (e.g., RNF170-FLAG) facilitate purification and detection

  • Stable cell lines can be generated using appropriate selection markers (e.g., G418)

Purification Protocol for Tagged RNF170:

  • Lyse cells in buffer containing 1% Triton X-100 and protease inhibitors

  • Clarify lysate by centrifugation (14,000 × g, 10 min)

  • Immunoprecipitate tagged RNF170 using appropriate affinity resin

  • Wash extensively to remove non-specific interactions

  • Elute with competitive peptide or low pH buffer

  • Analyze purity by SDS-PAGE and Coomassie staining (aim for >80% purity)

When working with recombinant RNF170, researchers should note that the protein typically migrates ~1 kDa more rapidly on SDS-PAGE than predicted, and expression levels can vary significantly between wild-type and mutant constructs .

  • What disease-associated mutations have been identified in RNF170 and what are their cellular effects?

Several clinically significant mutations in RNF170 have been identified across different species, each associated with distinct neurodegenerative conditions:

MutationInheritance PatternAssociated DiseaseCellular EffectsReference
R199C (human)Autosomal dominantSensory Ataxia (ADSA)Destabilizes protein, enhances autoubiquitination, impairs Ca²⁺ signaling via IP₃ receptors
c.396+3A>GAutosomal recessiveHereditary Spastic Paraplegia (SPG85)Causes exon 5 skipping, frameshift (p.Ala109Asnfs*9), loss of RING domain
g.42704626_42729012delinsTTTTGGTAutosomal recessiveHereditary Spastic Paraplegia (SPG85)Complete loss of function, accumulation of IP₃R
c.367delG (canine)Autosomal recessiveNeuroaxonal Dystrophy (NAD)Frameshift (p.Ala123Glnfs*11), early protein truncation

R199C Mutation:

This mutation disrupts salt bridges between transmembrane domains, causing:

  • Reduced protein stability (enhanced degradation)

  • ~1 kDa faster migration on SDS-PAGE

  • Impaired platelet-activating factor-induced Ca²⁺ mobilization despite normal:

    • Ca²⁺ store content

    • IP₃ receptor levels

    • IP₃ production

Recessive Mutations:

These mutations typically cause loss of function, resulting in:

  • 2.2-3.8-fold increase in basal IP₃R-3 levels in patient fibroblasts

  • Complete abolishment of IP₃R degradation upon stimulation

  • Accumulation of IP₃R-1 (to ~1.8-fold of wild-type levels) in knockout models

These findings highlight the different pathogenic mechanisms between dominant and recessive mutations, providing critical insights for developing targeted therapeutic strategies.

  • What methodological approaches are most effective for studying RNF170's role in calcium signaling?

Investigating RNF170's impact on calcium signaling requires a multi-faceted methodological approach:

Live-Cell Calcium Imaging

  • Fluorescent Indicators: Fura-2AM or Fluo-4AM loading allows ratiometric or intensity-based measurements of intracellular Ca²⁺ dynamics

  • Stimulus Protocol: Challenge cells with IP₃-generating agonists (e.g., platelet-activating factor, bradykinin) while monitoring Ca²⁺ transients

  • Parameters to Measure: Peak amplitude, area under curve, rise time, and decay kinetics of Ca²⁺ signals

  • Control Experiments: Assess Ca²⁺ store content using thapsigargin to inhibit SERCA pumps

IP₃ Receptor Degradation Assays

  • Stimulate cells with IP₃-generating agonists (e.g., bradykinin)

  • Harvest cells at different time points (0-60 min)

  • Analyze IP₃R levels by Western blotting

  • Quantify degradation kinetics (typically ~51% reduction in IP₃R-3 within 60 min in control cells)

Genetic Manipulation Models

  • CRISPR/Cas9 Knockout: Create complete RNF170 deletion to assess IP₃R accumulation (typically ~1.8-fold increase)

  • Rescue Experiments: Re-express wild-type RNF170 in knockout cells to confirm specificity

  • Patient-Derived Cells: Compare fibroblasts or lymphoblasts from patients carrying RNF170 mutations with control cells

IP₃ Production Measurements

  • Radiolabeling: Use [³H]inositol to label phospholipids, followed by extraction and HPLC analysis of IP₃ levels

  • ELISA-Based Detection: Commercial kits for quantifying IP₃ levels in cell extracts

Using this comprehensive approach, researchers have determined that the R199C mutation in RNF170 impairs Ca²⁺ mobilization without affecting Ca²⁺ store content, IP₃ receptor levels, or IP₃ production, indicating a functional defect at the IP₃ receptor locus .

Advanced Research Questions

  • What molecular mechanisms explain how the R199C mutation in RNF170 causes neurodegeneration in autosomal dominant sensory ataxia?

The R199C mutation in RNF170 triggers a cascade of molecular events that ultimately lead to neurodegeneration in autosomal dominant sensory ataxia (ADSA):

Primary Structural Disruption

The mutation occurs at a critical arginine residue (position 199 in humans, 198 in mice) that forms essential salt bridges between transmembrane domains 2 and 3 . These ionic interactions are crucial for maintaining protein stability. When arginine is replaced with cysteine, these salt bridges are disrupted, compromising the protein's structural integrity.

Enhanced Autoubiquitination and Protein Destabilization

The destabilized R199C mutant protein undergoes accelerated autoubiquitination, targeting it for proteasomal degradation . This results in:

  • Chronically reduced RNF170 protein levels

  • ~1 kDa faster migration on SDS-PAGE

  • Significantly reduced half-life compared to wild-type protein

Impaired Calcium Signaling

In ADSA lymphoblasts, platelet-activating factor-induced Ca²⁺ mobilization is significantly impaired, despite normal:

  • Ca²⁺ store content

  • IP₃ receptor levels

  • IP₃ production

This indicates a functional defect at the IP₃ receptor locus. Interestingly, wild-type and mutant RNF170 have apparently identical ubiquitin ligase activities toward IP₃ receptors , suggesting the defect likely reflects abnormal ubiquitination of other substrates or cellular adaptation to chronically reduced RNF170 levels.

Neuron-Specific Vulnerability

The posterior columns of the spinal cord are particularly affected in ADSA, suggesting these neurons may be especially sensitive to:

  • Disruptions in calcium homeostasis

  • Altered ubiquitination of specific RNF170 substrates important for their function

  • Chronic adaptive responses to reduced RNF170 levels that become detrimental over time

This complex pathogenic mechanism explains why the R199C mutation causes a dominant phenotype despite apparent normal ubiquitination of IP₃ receptors, and provides insights for potential therapeutic interventions targeting protein stabilization or calcium signaling modulation .

  • How does the ERLIN1/2 complex coordinate with RNF170 to regulate IP3 receptor degradation?

The ERLIN1/2 complex plays a pivotal role in orchestrating RNF170-mediated IP₃ receptor degradation through a sophisticated recruitment mechanism:

Structural Organization

ERLIN1 and ERLIN2 form large ring-like cup-shaped structures on the ER membrane that serve as specialized scaffolding platforms . These structures create microdomains that concentrate and organize the machinery necessary for efficient IP₃ receptor processing.

Sequential Recruitment Process

The regulation follows a precise order of events:

  • IP₃ receptors are activated by IP₃ binding

  • The ERLIN1/2 complex rapidly binds to activated IP₃ receptors

  • RNF170, a substantial proportion of which is constitutively associated with the ERLIN1/2 complex, is recruited to these activated receptors

  • RNF170 mediates the ubiquitination of IP₃ receptors, adding monoubiquitin and Lys48- and Lys63-linked ubiquitin chains

  • Ubiquitinated IP₃ receptors are targeted for degradation via the ubiquitin-proteasome pathway

Dependency Relationship

Experimental evidence establishes a clear hierarchical relationship:

  • Depletion of RNF170 does not affect the binding of the ERLIN1/2 complex to stimulated IP₃ receptors

  • ERLIN1/2 complex depletion inhibits RNF170 binding to IP₃ receptors

This confirms that the ERLIN1/2 complex acts upstream of RNF170 in the degradation pathway.

Additional Bridging Proteins

Recent research indicates that ERLIN1/2 scaffolds bridge TMUB1 and RNF170 . TMUB1-L (a specific isoform of TMUB1) co-immunoprecipitates with ERLIN1 and ERLIN2, suggesting a more complex multiprotein assembly than previously recognized.

Understanding this coordinated mechanism provides potential intervention points for modulating IP₃ receptor levels and calcium signaling in various disease contexts, particularly neurodegenerative disorders associated with RNF170 mutations.

  • What methods are most effective for analyzing salt bridge interactions in transmembrane domains of RNF170?

Analyzing salt bridge interactions in transmembrane domains requires specialized techniques due to their location within the lipid bilayer:

Computational Approaches

  • Molecular Dynamics Simulations:

    • Simulate RNF170 behavior in a lipid bilayer environment

    • Calculate electrostatic interaction energies between charged residues

    • Predict stability changes upon mutation (e.g., R199C)

    • Monitor salt bridge formation, breaking, and lifetimes during simulation

  • Homology Modeling and Electrostatic Analysis:

    • Generate 3D structural models based on related proteins

    • Identify potential salt bridge pairs between charged residues

    • Predict the impact of mutations on protein stability

Experimental Validation

  • Site-Directed Mutagenesis Combined with Expression Analysis:

    • Systematically mutate charged residues (Arg, Lys, Glu, Asp) to neutral amino acids

    • Analyze effects on protein expression and stability by Western blotting

    • Examine migration patterns on SDS-PAGE (e.g., the R199C mutation causes ~1kDa faster migration)

  • Charge-Swap Experiments:

    • Replace positive charges with negative ones and vice versa

    • Test for rescue of protein stability when complementary mutations are introduced

    • Example: If R199 forms a salt bridge with D222, then R199E/D222R double mutant might restore stability

  • Proteasome Inhibition Studies:

    • Treat cells expressing wild-type or mutant RNF170 with proteasome inhibitors

    • Quantify accumulation of protein to assess relative stability

    • Compare ubiquitination patterns between wild-type and mutant proteins

Research has demonstrated that ionic interactions between charged residues in the transmembrane domains of RNF170 are critical for protein stability. When Arg198/199 is replaced with serine (which cannot form disulfide bonds), the protein still shows poor expression and rapid migration similar to the R198C/R199C mutation, confirming that disruption of ionic interactions rather than aberrant disulfide bond formation is responsible for the observed effects .

  • How can researchers effectively investigate differences in ubiquitin ligase activity between wild-type and mutant RNF170?

Investigating differences in ubiquitin ligase activity between wild-type and mutant RNF170 requires methodologies that can directly assess ubiquitination of target proteins:

In Vitro Ubiquitination Assays

  • Reconstituted System:

    • Purify recombinant wild-type and mutant RNF170

    • Combine with E1, E2 enzymes, ubiquitin, ATP, and substrate (e.g., IP₃R fragment)

    • Incubate and analyze ubiquitination by Western blot

    • Quantify different ubiquitin chain types (mono-, K48-, K63-linked)

  • RING Domain Activity Assessment:

    • Create constructs expressing only the RING domain of wild-type or mutant RNF170

    • Test intrinsic catalytic activity without transmembrane domain effects

    • Compare autoubiquitination as a measure of enzyme activity

Cellular Ubiquitination Assays

  • Stimulus-Induced IP₃R Ubiquitination:

    • Express wild-type or mutant RNF170 in cells

    • Stimulate with IP₃-generating agonists (e.g., bradykinin)

    • Immunoprecipitate IP₃Rs and blot for ubiquitin conjugates

    • Analyze ubiquitination patterns with chain-specific antibodies

  • Pulse-Chase Analysis of IP₃R Degradation:

    • Metabolically label IP₃Rs with [³⁵S]methionine/cysteine

    • Chase in presence of stimulus

    • Immunoprecipitate IP₃Rs and quantify degradation rate

    • Compare between wild-type and mutant RNF170-expressing cells

  • Complementation in RNF170-Knockout Cells:

    • Use CRISPR/Cas9 to generate RNF170-null cells

    • Reintroduce wild-type or mutant RNF170

    • Measure rescue of IP₃R ubiquitination and degradation

    • Quantify IP₃R accumulation (typically 1.8-fold increase in knockout cells)

Specific Findings for RNF170 Mutations

Research has revealed that wild-type and R199C mutant RNF170 have apparently identical ubiquitin ligase activities toward IP₃ receptors, despite the calcium mobilization defect seen in ADSA lymphoblasts . This surprising finding suggests that the defect likely reflects:

  • Abnormal ubiquitination of other, currently unknown substrates

  • Cellular adaptation to chronically reduced RNF170 levels

  • Subtle alterations in ubiquitination dynamics not detected by steady-state analysis

These findings highlight the importance of comprehensive analysis beyond simple activity measurements when investigating disease-causing mutations in ubiquitin ligases.

  • What experimental approaches can identify novel substrates of RNF170 beyond IP3 receptors?

Identifying novel RNF170 substrates requires systematic approaches that can capture transient enzyme-substrate interactions and differentiate direct from indirect effects:

Proximity-Based Approaches

  • BioID/TurboID Proximity Labeling:

    • Generate RNF170 fusions with biotin ligase (BioID2 or TurboID)

    • Express in relevant cell types and provide biotin

    • Isolate biotinylated proteins and identify by mass spectrometry

    • Compare substrates between wild-type and catalytically inactive RNF170

  • APEX2 Proximity Labeling:

    • Create RNF170-APEX2 fusion proteins

    • Treat cells with biotin-phenol and H₂O₂

    • Purify biotinylated proteins and analyze by mass spectrometry

    • Offers higher temporal resolution than BioID

Ubiquitome Analysis

  • Di-Gly Remnant Profiling:

    • Compare ubiquitinated proteomes between control and RNF170-depleted cells

    • Enrich for peptides with di-glycine remnants after trypsin digestion

    • Identify by mass spectrometry

    • Quantify changes in ubiquitination sites

  • Tandem Ubiquitin Binding Entity (TUBE) Pulldowns:

    • Use TUBEs to capture ubiquitinated proteins

    • Compare profiles between wild-type, RNF170-knockout, and rescued cells

    • Identify differentially ubiquitinated proteins by mass spectrometry

Genetic and Proteomic Screening

  • Synthetic Lethal Screens:

    • Perform genome-wide CRISPR screens in RNF170-deficient backgrounds

    • Identify genes whose loss is only detrimental when RNF170 is absent

    • These often represent parallel pathways affecting the same substrates

  • Protein Stability Profiling:

    • Use global protein stability (GPS) or tandem mass tag (TMT) approaches

    • Compare protein half-lives between control and RNF170-deficient cells

    • Proteins stabilized in the absence of RNF170 are potential substrates

Candidate Approach

  • ER-Resident Calcium Regulators:

    • Given RNF170's role in calcium signaling, systematically test:

      • Other calcium channels (e.g., SERCA pumps, Orai channels)

      • ER-resident calcium-binding proteins (e.g., calreticulin, calnexin)

      • Components of store-operated calcium entry (SOCE)

The calcium mobilization defect seen in ADSA lymphoblasts despite apparently normal IP₃R ubiquitination strongly suggests the existence of additional RNF170 substrates relevant to neurodegeneration . Identifying these substrates would provide crucial insights into disease mechanisms and potential therapeutic targets.

  • What experimental models are most appropriate for studying RNF170-related neurodegenerative diseases?

Multiple experimental models offer complementary advantages for studying RNF170-related neurodegenerative disorders:

Cellular Models

  • Patient-Derived Cells:

    • Lymphoblasts: From ADSA patients carrying the R199C mutation show impaired platelet-activating factor-induced Ca²⁺ mobilization

    • Fibroblasts: From HSP patients with bi-allelic RNF170 mutations demonstrate 2.2-3.8-fold increase in basal IP₃R-3 levels and abolished IP₃R degradation upon stimulation

    • iPSC-Derived Neurons: Can recapitulate neuron-specific phenotypes and allow longitudinal studies of neurodegeneration

  • Engineered Cell Lines:

    • CRISPR/Cas9 Knockout Models: SH-SY5Y neuroblastoma cells with RNF170 deletion show 1.8-fold accumulation of IP₃R-1

    • Point Mutation Knock-in Lines: Can precisely model specific disease mutations

    • Rescue Models: Re-expression of wild-type RNF170 in knockout cells confirms specificity of observed phenotypes

Animal Models

  • Zebrafish Models:

    • Morpholino Knockdown: Disruption of rnf170 leads to neurodevelopmental defects

    • CRISPR/Cas9 Mutants: Allow study of developmental and adult phenotypes

    • Advantages: Optical transparency allows in vivo calcium imaging; rapid development

  • Canine Models:

    • Miniature American Shepherd Dogs: Natural model with RNF170 single base deletion causing neuroaxonal dystrophy

    • Disease Progression: Young adult onset, slowly progressive neurodegenerative syndrome

    • Advantages: Naturally occurring model with relatively long lifespan; excellent for therapeutic trials

    • Clinical Manifestation: Abnormal gait characterized by pelvic limb weakness and ataxia

  • Mouse Models:

    • Conditional Knockouts: Allow tissue-specific and temporal control of RNF170 deletion

    • Knock-in Models: Can precisely replicate human mutations (e.g., R199C)

    • Advantages: Mammalian nervous system; extensive behavioral testing possible

Ex Vivo Models

  • Organotypic Slice Cultures:

    • Maintain neural circuit architecture while allowing manipulation and imaging

    • Particularly useful for studying posterior column degeneration in ADSA

Comparative Analysis of Model Systems

ModelAdvantagesLimitationsBest Applications
Patient CellsDirect disease relevanceLimited to accessible cell typesInitial phenotype identification, drug screening
CRISPR Cell LinesPrecise genetic controlMay lack tissue contextMechanistic studies, high-throughput screening
ZebrafishIn vivo calcium imaging, rapidEvolutionary distance from humansDevelopmental studies, initial drug screening
Canine ModelsNatural disease course, large brainLimited genetic manipulationPre-clinical therapeutic trials
Mouse ModelsMammalian nervous systemPhenotype may differ from humanComprehensive in vivo disease modeling

The canine model is particularly valuable as it demonstrates a phenotype (neuroaxonal dystrophy) similar to human hereditary spastic paraplegia (SPG85) caused by RNF170 mutations, providing an excellent large animal model for therapeutic trials .

  • What methodological approaches can effectively assess calcium signaling defects in RNF170 mutant systems?

Comprehensive assessment of calcium signaling defects in RNF170 mutant systems requires multiple complementary methodologies:

Real-Time Calcium Imaging

  • Ratiometric Measurements with Fura-2AM:

    • Allows quantitative comparison of baseline and peak Ca²⁺ levels

    • Dual-excitation (340/380 nm) eliminates artifacts from dye concentration

    • Protocol for ADSA lymphoblasts:

      • Load cells with 2 μM Fura-2AM for 30 minutes at 37°C

      • Measure baseline F340/F380 ratio

      • Stimulate with platelet-activating factor (100 nM)

      • Record Ca²⁺ transients for 5 minutes

      • Analyze peak amplitude, area under curve, and decay kinetics

  • High-Content Calcium Imaging:

    • Simultaneous analysis of thousands of cells

    • Captures population heterogeneity

    • Enables identification of cell subpopulations with distinct responses

Store Content and Calcium Flux Assessment

  • Store Content Measurement:

    • Treat cells with thapsigargin (SERCA inhibitor) in Ca²⁺-free medium

    • Amplitude of resulting Ca²⁺ transient indicates ER store content

    • Essential control to determine if signaling defects are due to depleted stores

  • Store-Operated Calcium Entry (SOCE):

    • Deplete stores with thapsigargin in Ca²⁺-free medium

    • Reintroduce extracellular Ca²⁺

    • Measure resulting Ca²⁺ influx to assess SOCE function

    • Important for examining potential compensatory mechanisms

IP₃ Pathway Components Analysis

  • IP₃ Production Measurement:

    • Stimulate cells with appropriate agonist

    • Extract and measure IP₃ levels using competitive binding assays

    • Determines if signaling defects are due to impaired IP₃ generation

  • IP₃ Receptor Expression and Distribution:

    • Quantify IP₃R protein levels by Western blotting

    • Assess subcellular localization by immunofluorescence

    • Examine receptor clustering using super-resolution microscopy

Advanced Techniques

  • Genetically-Encoded Calcium Indicators (GECIs):

    • Express G-CAMP6f or R-GECO in specific cellular compartments

    • Enables targeted measurement of Ca²⁺ in ER, mitochondria, or near plasma membrane

    • Particularly useful in neuronal models

  • Electrophysiological Recordings:

    • Patch-clamp analysis of calcium currents

    • Direct measurement of IP₃R channel activity in lipid bilayers

    • Highest temporal resolution for detecting subtle functional changes

Research Findings in RNF170 Mutant Systems

In ADSA lymphoblasts carrying the R199C mutation:

  • Platelet-activating factor-induced Ca²⁺ mobilization is significantly impaired

  • Ca²⁺ store content remains normal

  • IP₃ receptor levels are unchanged

  • IP₃ production is unaffected

These findings indicate a functional defect at the IP₃ receptor locus that is not due to changes in receptor abundance or IP₃ generation, highlighting the importance of comprehensive methodology to pinpoint the exact mechanism of calcium signaling dysregulation.

By systematically applying these approaches, researchers can precisely characterize the calcium signaling defects in various RNF170 mutant systems and develop targeted therapeutic interventions.

  • What potential therapeutic strategies could target RNF170-related neurodegeneration?

Based on our understanding of RNF170 pathophysiology, several promising therapeutic strategies could be developed:

Targeting Protein Stability and Function

  • Pharmacological Chaperones:

    • Small molecules that bind and stabilize mutant RNF170 (especially R199C)

    • Prevent enhanced autoubiquitination and proteasomal degradation

    • Potential screening approach: thermal shift assays with recombinant RNF170 variants

  • Protein-Protein Interaction Modulators:

    • Compounds that stabilize interactions between RNF170 and the ERLIN1/2 complex

    • Enhance recruitment of RNF170 to activated IP₃ receptors

    • May compensate for reduced RNF170 levels in dominant mutations

Genetic Approaches

  • Gene Therapy Strategies:

    • For Recessive Mutations: AAV-mediated delivery of functional RNF170

    • For Dominant Mutations: Allele-specific silencing using antisense oligonucleotides or CRISPR-based approaches

    • Feasibility: The compact size of RNF170 cDNA (~774 bp) is advantageous for viral packaging

  • RNA-Based Therapeutics:

    • Antisense Oligonucleotides (ASOs): Target mutant RNF170 mRNA for degradation

    • siRNA: Knockdown of mutant allele expression

    • Delivery Considerations: Blood-brain barrier penetration crucial for CNS disorders

Modulating Calcium Signaling

  • IP₃ Receptor Modulators:

    • Direct targeting of downstream effectors rather than RNF170 itself

    • Compounds that stabilize IP₃R in open or closed states depending on disease mechanism

    • Example compounds: xestospongin C (IP₃R antagonist) or adenophostin A (IP₃R agonist)

  • Calcium Homeostasis Regulators:

    • SERCA activators to enhance ER Ca²⁺ reuptake

    • Mitochondrial calcium uptake enhancers to buffer cytosolic Ca²⁺

    • Particularly relevant for disorders with impaired Ca²⁺ mobilization (e.g., ADSA)

Targeting Protein Degradation Pathways

  • E3 Ligase Modulators:

    • For loss-of-function mutations: Compounds that enhance activity of compensatory E3 ligases

    • For gain-of-function effects: Selective inhibitors of aberrant ubiquitination

  • Proteasome Modulation:

    • Low-dose proteasome inhibitors to reduce degradation of mutant RNF170

    • Must be carefully titrated to avoid general proteotoxicity

Preclinical Testing Opportunities

The identification of a canine model of neuroaxonal dystrophy caused by an RNF170 mutation provides an excellent large animal model for testing therapeutic strategies . The relatively long lifespan of affected dogs represents a unique opportunity for therapeutic trials with direct relevance to human disease.

Therapeutic Development Considerations

Therapeutic ApproachBest ForDevelopment ChallengesPotential Advantages
Pharmacological ChaperonesDominant mutations (R199C)Specific binding to transmembrane regionsCould restore normal protein levels without genetic modification
Gene TherapyRecessive loss-of-functionCNS delivery, potential immune responseOne-time treatment with lasting effects
ASOs/siRNAsDominant mutationsBlood-brain barrier penetrationHigh specificity for mutant allele
IP₃R/Ca²⁺ ModulatorsBoth dominant and recessiveTarget specificity, side effectsAddresses downstream effects regardless of mutation type

Understanding the precise mechanisms by which different RNF170 mutations cause neurodegeneration will be crucial for selecting the most appropriate therapeutic approach for each disorder.

  • How can researchers effectively integrate in vitro, cellular, and animal model findings to understand RNF170 pathophysiology?

Developing a comprehensive understanding of RNF170 pathophysiology requires strategic integration of findings across multiple experimental systems:

Systematic Cross-Model Validation Framework

  • Molecular Mechanism Confirmation:

    • Identify key molecular alterations in patient-derived cells

    • Recreate these alterations in engineered cell lines via CRISPR/Cas9

    • Validate in animal models to confirm in vivo relevance

    • Example application: The R199C mutation destabilizes RNF170 in patient lymphoblasts , can be confirmed in CRISPR knock-in cell lines, and ultimately validated in mouse models

  • Hierarchical Phenotype Analysis:

    • Begin with biochemical assays (e.g., IP₃R ubiquitination patterns)

    • Progress to cellular phenotypes (e.g., calcium signaling dynamics)

    • Extend to tissue/organ-level effects (e.g., neuronal morphology)

    • Culminate with system-level manifestations (e.g., motor function)

  • Temporal Dimension Integration:

    • Acute effects: Direct biochemical consequences (minutes to hours)

    • Intermediate adaptations: Compensatory cellular responses (days to weeks)

    • Chronic consequences: Progressive neurodegeneration (months to years)

    • Example: Initial IP₃R accumulation → altered calcium homeostasis → eventual neuronal dysfunction

Data Integration Methodologies

  • Quantitative Systems Pharmacology (QSP):

    • Develop mathematical models integrating RNF170 function, IP₃R dynamics, and calcium signaling

    • Parameterize models using in vitro and cellular data

    • Validate predictions in animal models

    • Use to predict therapeutic responses

  • Multi-Omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics data across models

    • Identify conserved pathways affected by RNF170 dysfunction

    • Use network analysis to highlight potential compensatory mechanisms

Translational Research Pipeline

  • Biomarker Development Strategy:

    • Identify biochemical markers in cellular models (e.g., IP₃R accumulation)

    • Validate in animal models (e.g., CSF or plasma markers)

    • Translate to patient samples for clinical correlation

    • Critical for monitoring disease progression and treatment response

  • Therapeutic Testing Cascade:

    • Initial screening in engineered cell lines

    • Validation in patient-derived cells

    • Preclinical testing in zebrafish and mouse models

    • Advanced testing in canine models before human trials

Research Implementation Example

The integration approach has already yielded insights into RNF170 pathophysiology:

  • Initial Discovery: Biallelic RNF170 mutations identified in HSP patients

  • Cellular Validation: Patient fibroblasts show IP₃R accumulation and abolished degradation

  • Engineered Model Confirmation: CRISPR/Cas9 knockout SH-SY5Y cells replicate IP₃R accumulation

  • Rescue Experiments: Re-expression of wild-type RNF170 normalizes IP₃R levels

  • Animal Model Validation: Knockdown of rnf170 in zebrafish causes neurodevelopmental defects

  • Natural Animal Model Discovery: Canine RNF170 mutation causes similar neurological disease

This integrated approach has established inositol 1,4,5-trisphosphate signaling as a key pathway for hereditary spastic paraplegias and cerebellar ataxias, prioritizing it for therapeutic interventions .

By systematically integrating findings across experimental models, researchers can develop a comprehensive understanding of RNF170 pathophysiology and identify the most promising therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.