Recombinant Human RING finger protein 186 (RNF186)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF186; E3 ubiquitin-protein ligase RNF186; RING finger protein 186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF186
Target Protein Sequence
MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQH
AFCAICLKLLLCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCP
QGLVDPADLAAGHPSLVGEDGQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRW
VLTFIIALALLMSTLFCCLPSTRGSCWPSSRTLFCREQKHSHISSIA
Uniprot No.
Target Background
Function
RNF186 is an E3 ubiquitin protein ligase involved in an apoptotic signaling pathway triggered by endoplasmic reticulum (ER) stress. It stimulates the expression of unfolded protein response (UPR)-specific proteins, ubiquitinates BNIP1, regulates its mitochondrial localization, and induces calcium release from the ER, ultimately leading to apoptosis.
Gene References Into Functions
- A predicted protein-truncating variant (rs36095412, p.R179X) in RNF186, a single-exon ring finger E3 ligase with significant colonic expression, shows a protective effect against ulcerative colitis (genotyped in 11,148 ulcerative colitis patients and 295,446 controls, MAF=up to 0.78%). PMID: 27503255
- Our findings confirmed significant associations with rare non-synonymous coding variants in IL23R and CARD9 (previously identified from CD locus sequencing), and identified a novel association in RNF186. PMID: 24068945
- BNIP1 acts as a downstream effector of RNF186, mediating ER stress-associated apoptotic signaling. PMID: 23896122
- A single-nucleotide polymorphism in the RNF186 gene is associated with ulcerative colitis. PMID: 23511034
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
