Recombinant Human RING finger protein 222 (RNF222)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human RING finger protein 222 (RNF222) is a protein encoded by the RNF222 gene in humans . RNF222 is also known under the following names: RING finger protein 222 [Cleaved into: C-terminal cleavage product; N-terminal cleavage product] . The protein contains a RING finger domain, which is a specialized type of zinc finger domain known to be involved in protein-protein interactions, and often associated with E3 ubiquitin ligase activity . Ubiquitin ligases play a critical role in the ubiquitination pathway, which marks proteins for degradation or alters their function.

Gene Information

The RNF222 gene is located on chromosome 8 in humans . The Rat Genome Database provides detailed reports on Rnf222, including genomic location and links to expression data . The gene is associated with the following:

  • HGNC: 34517

  • KEGG: hsa:643904

  • STRING: 9606.ENSP00000343799

  • UniGene: Hs.526550

Expression and Localization

RNF222 exhibits varied expression across different tissues . Expression data can be found in The Human Protein Atlas, which provides comprehensive information on gene expression patterns in human tissues .

Recombinant RNF222

Recombinant RNF222 is produced in various expression systems, including Yeast, E. coli, Baculovirus, and Mammalian cells . Recombinant proteins are useful for in vitro and in vivo studies aimed at understanding protein function, identifying interacting partners, and developing potential therapeutics.

miRNA Target Status

miRNA Target prediction data is available for RNF222 . According to the Rat Genome Database, there are 529count of predictions, 258 count of miRNA genes and 308 interacting mature miRNAs .

Data Table

FeatureDescription
Gene NameRING finger protein 222
AliasRNF222
Chromosome LocationChromosome 8
Protein Length220 amino acids
DomainRING finger domain
FunctionProbable E3 ubiquitin ligase
ExpressionVaried expression across tissues
Recombinant ProductionAvailable in Yeast, E. coli, Baculovirus and Mammalian cell expression systems
Associated TermsHGNC: 34517, KEGG: hsa:643904, STRING: 9606.ENSP00000343799, UniGene: Hs.526550

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF222; RING finger protein 222
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RNF222
Target Protein Sequence
MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLV CPICRYVTFLSKKSSRWPSMLDKSSQTLAVPVGLPSVPPLDSLGHTNPLAASSPAWRPPP GQARPPGSPGQSAQLPLDLLPSLPRESQIFVISRHGMPLGEQDSVLPRRSLAELSEASLA PRSARAFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQA
Uniprot No.

Target Background

Database Links

HGNC: 34517

KEGG: hsa:643904

STRING: 9606.ENSP00000343799

UniGene: Hs.526550

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is RNF222 and what structural domains does it contain?

RNF222 (Ring Finger Protein 222) is a protein-coding gene that encodes a protein containing a C3HC4 RING finger domain. This domain is characterized by a specific pattern of cysteine and histidine residues that coordinate zinc ions. The protein contains 220 amino acids in humans, with the RING finger domain being critical for its predicted function . Similar to other RING finger proteins, RNF222 likely contains metal ion binding sites that are essential for its structural integrity and function . The protein sequence analysis suggests similarities to other RING finger proteins that function as E3 ubiquitin ligases, though this activity has not been directly demonstrated for RNF222 specifically .

What is the genomic location and organization of the human RNF222 gene?

The human RNF222 gene is located on chromosome 17p13.1 (NC_000017.11, positions 8390702-8397827 on the complement strand) . The gene comprises 4 exons and spans approximately 7,125 base pairs. The mRNA transcript (such as accession XM_012871068.1 in other species) encodes the full RNF222 protein. The gene has been annotated in the NCBI Reference Sequence Database (RefSeq) and has the Entrez Gene ID: 643904 . This genomic organization is important for researchers designing primers for expression studies or planning genetic manipulation experiments.

What is known about RNF222 expression patterns in human tissues?

While the search results don't provide specific information about RNF222 expression patterns across human tissues, this represents an important knowledge gap that researchers might want to address. By comparison, other RING finger proteins show tissue-specific expression patterns. For example, ZNF645, another RING finger protein, is exclusively expressed in testicular tissue, specifically in spermatocytes, round and elongated spermatids, and Leydig cells . Understanding RNF222 expression patterns would help researchers focus their studies on relevant physiological contexts.

What methods are available for recombinant expression and purification of human RNF222?

Based on similar approaches with other RING finger proteins, researchers can express recombinant human RNF222 using several systems:

  • Mammalian expression system: RNF222 can be expressed in HEK-293 cells with a His-tag for purification purposes . This approach is particularly valuable when post-translational modifications or proper folding is essential for functional studies.

  • Bacterial expression system: For structural studies or in vitro biochemical assays, RNF222 can be expressed as a GST fusion protein in E. coli, similar to the approach used for other RING finger domains .

The purification protocol typically involves:

  • One-step affinity chromatography using nickel columns for His-tagged proteins

  • Verification of purity (>90%) using methods such as:

    • Bis-Tris PAGE

    • Anti-tag ELISA

    • Western Blot

    • Analytical SEC (HPLC)

For optimal results, expressing just the RING finger domain (rather than the full-length protein) may increase solubility and stability for certain applications.

How can researchers assess the potential E3 ubiquitin ligase activity of RNF222?

To determine whether RNF222 has intrinsic E3 ubiquitin ligase activity (similar to other RING finger proteins), researchers can perform an in vitro ubiquitination assay following this methodology:

  • Prepare recombinant proteins:

    • Generate GST fusion proteins containing the RING finger domain of RNF222

    • Prepare or acquire commercial E1 (ubiquitin-activating enzyme)

    • Express and purify GST-UBC4 or another appropriate E2 ubiquitin-conjugating enzyme

    • Include a well-characterized RING E3 ligase (such as GST-c-Cbl) as a positive control

  • Perform the ubiquitination reaction:

    • Mix E1, E2, GST-RNF222, ubiquitin, and ATP in appropriate buffer

    • Incubate at 30°C for 1-2 hours

    • Analyze by SDS-PAGE followed by western blotting with anti-ubiquitin antibodies

  • Verification of E3 activity:

    • The formation of polyubiquitin chains in the presence of RNF222 would indicate E3 ligase activity

    • Include appropriate controls (reactions lacking E1, E2, ATP, or RNF222)

This methodology follows established protocols used to determine the E3 ubiquitin ligase activity of other RING finger proteins such as ZNF645 .

What CRISPR-Cas9 strategies can be used to study RNF222 function in cell lines?

CRISPR-Cas9 genome editing can be effectively used to investigate RNF222 function through the following approaches:

  • Complete knockout strategy:

    • Design sgRNAs targeting exons of RNF222 (preferably early exons)

    • Use the CRISPR-Cas9 double nickase method to increase specificity and reduce off-target effects

    • Validate knockout by sequencing the target region and confirming the presence of indels that cause frameshifts or premature stop codons

    • Verify protein loss using western blotting

  • Validation of on-target editing:

    • Generate an average of ~17,000 reads per sample through targeted sequencing

    • After trimming, sorting, and indel realignment, analyze ~16,800 reads

    • Confirm the presence of insertions/deletions at the targeted site

    • Verify absence of mutations in predicted off-target regions

  • Functional analysis:

    • Examine phenotypic changes in RNF222-knockout cells

    • Perform RNA-seq to identify differentially expressed genes

    • Conduct protein interaction studies to identify binding partners

    • Utilize rescue experiments with wild-type and mutant RNF222 to confirm specificity

This approach has been successfully used to study RNF213, another RING finger protein, revealing its role in cerebral endothelium integrity .

What is known about RNF222's potential role in ubiquitination pathways?

Based on structural similarities with other RING finger proteins, RNF222 likely functions in ubiquitination pathways. RING finger domains typically serve as scaffolds that bring E2 ubiquitin-conjugating enzymes and substrates into close proximity, facilitating the transfer of ubiquitin to target proteins .

While the specific targets and pathways of RNF222 are not yet well-characterized in the provided search results, comparisons with other RING finger proteins suggest potential roles in:

  • Protein quality control: Many RING E3 ligases are involved in targeting misfolded or damaged proteins for degradation

  • Cell cycle regulation: RING finger proteins often regulate cell cycle progression through the timely degradation of cyclins and other regulatory proteins

  • Gene expression regulation: Some RING finger proteins, such as RNF2, function as transcriptional repressors by participating in chromatin remodeling complexes

To identify specific substrates of RNF222, researchers could employ:

  • Proximity-based biotinylation (BioID)

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screens

  • Protein arrays incubated with the recombinant RNF222

How does RNF222 compare to other well-characterized RING finger proteins?

RNF222 shares structural similarities with other RING finger proteins, but distinct functional characteristics differentiate these proteins:

RING ProteinStructural FeaturesFunctionCellular LocalizationReference
RNF222RING finger domain, 220 amino acidsNot yet fully characterizedPredicted to be in membrane
RNF2RING finger domain, component of PRC1Transcriptional repressor, E3 ligaseNuclear
RNF213RING finger domainRegulator of endothelial cell integrityEndothelial cells
RNF20Primary E3 ubiquitin ligase for histone H2BMediates RNA polymerase II promoter-proximal pausingNuclear
ZNF645C3HC4 RING finger domain, C2H2 zinc-finger domainE3 ubiquitin ligase in testicular tissueCytoplasm of spermatocytes, spermatids, Leydig cells

Understanding these similarities and differences can help researchers formulate hypotheses about RNF222's potential functions and guide experimental design.

What genomic and transcriptomic approaches can reveal RNF222's function in different cellular contexts?

To elucidate RNF222's function in various cellular contexts, researchers can employ several genomic and transcriptomic approaches:

  • ChIP-seq analysis:

    • Perform chromatin immunoprecipitation with RNF222 antibodies

    • Identify genomic binding sites of RNF222

    • Analyze potential regulatory roles based on binding patterns

  • RNA-seq following RNF222 manipulation:

    • Compare gene expression profiles between wild-type and RNF222 knockout/knockdown cells

    • Identify pathways affected by RNF222 loss using Gene Set Enrichment Analysis (GSEA)

    • Validate key differentially expressed genes by RT-qPCR

  • Single-cell approaches:

    • Perform single-cell RNA-seq to identify cell-type-specific roles of RNF222

    • Use the "single-mouse experimental design" for efficient in vivo studies

    • Employ this approach to assess the effects of RNF222 manipulation in complex tissues

  • Functional genomics screens:

    • Conduct CRISPR screens to identify synthetic lethal interactions with RNF222

    • Use CRISPRi/CRISPRa libraries to identify pathways that interact with RNF222 function

    • Apply computational prediction methods like StarFunc to uncover potential functions

These approaches have been successfully employed to characterize other RING finger proteins and could be adapted for RNF222 studies.

What is known about RNF222 mutations or expression changes in disease contexts?

The search results don't provide specific information about RNF222 mutations in diseases, but the COSMIC database indicates that RNF222 mutations have been observed in cancer samples . Based on knowledge of other RING finger proteins, potential implications include:

  • Cancer associations: Other RING finger proteins like RNF2 have been implicated in various cancers, suggesting RNF222 might also have oncogenic or tumor suppressor roles depending on context

  • Potential role in immunomodulation: RNF2 has been shown to reprogram the tumor-immune microenvironment, suggesting that other RING finger proteins like RNF222 might have similar functions

  • Vascular disease connections: RNF213, another RING finger protein, is associated with Moyamoya disease and regulates cerebral endothelium integrity, pointing to potential vascular roles for RING domain proteins

Researchers interested in disease associations could:

  • Analyze public cancer genomics databases for RNF222 mutations

  • Examine expression levels in cancer vs. normal tissues

  • Look for associations with clinical outcomes

  • Investigate potential roles in immune regulation

How might structural knowledge of RNF222 inform potential therapeutic approaches?

Understanding the structure of RNF222, particularly its RING finger domain, could guide therapeutic development through several approaches:

  • Structure-based drug design:

    • Determine the three-dimensional structure of RNF222's RING finger domain using X-ray crystallography or NMR

    • Identify potential binding pockets for small molecule inhibitors

    • Design compounds that could disrupt E3 ligase activity or protein-protein interactions

  • Protein-protein interaction inhibitors:

    • Characterize interactions between RNF222 and its E2 partners

    • Develop peptides or small molecules that disrupt these interactions

    • Use fragment-based screening to identify lead compounds

  • PROTAC approach:

    • Leverage RNF222's potential E3 ligase activity to develop PROteolysis TArgeting Chimeras (PROTACs)

    • Create bifunctional molecules that bring RNF222 into proximity with target proteins for degradation

    • This approach is being explored with other E3 ligases and could be applied to RNF222 if its substrates are identified

  • Modification of ubiquitination sites:

    • Similar to studies with PPARγ1 where lysine 222 was identified as a key ubiquitination site for MuRF2-mediated modification

    • Identify critical ubiquitination sites on RNF222 substrates

    • Develop strategies to protect these sites from modification

These approaches would require detailed structural and functional characterization of RNF222 that builds upon knowledge gained from studies of related RING finger proteins.

What are the challenges in developing specific antibodies against human RNF222?

Developing specific antibodies against RNF222 presents several challenges that researchers should consider:

  • Sequence similarity with other RING finger proteins:

    • The RING finger domain is highly conserved across proteins

    • Antibodies may cross-react with related proteins, requiring careful validation

  • Production of antigens:

    • Recombinant expression challenges may include protein insolubility or incorrect folding

    • Consider using unique peptide sequences outside the RING domain as antigens

    • Alternatively, generate His-tagged RNF222 fragments for immunization

  • Validation strategies:

    • Perform western blot analysis comparing wild-type and RNF222-knockout cells

    • Conduct immunoprecipitation followed by mass spectrometry to confirm specificity

    • Test antibodies on tissue arrays to evaluate cross-reactivity patterns

  • Application-specific considerations:

    • Different applications (WB, IHC, IP, ChIP) may require different antibody characteristics

    • For ChIP experiments, ensure the antibody can recognize native (non-denatured) protein

Researchers should employ rigorous validation protocols similar to those used for other RING finger proteins to ensure antibody specificity.

How can researchers investigate RNF222's role in protein ubiquitination networks?

To investigate RNF222's role in protein ubiquitination networks, researchers can employ these methodological approaches:

  • Ubiquitinome analysis:

    • Compare the global ubiquitination profile between control and RNF222-deficient cells using ubiquitin remnant profiling mass spectrometry

    • Enrich ubiquitinated proteins using tandem ubiquitin binding entities (TUBEs)

    • Identify proteins with altered ubiquitination status as potential RNF222 substrates

  • E2 enzyme interaction profiling:

    • Screen a panel of E2 enzymes to identify those that partner with RNF222

    • Perform in vitro ubiquitination assays with different E2 enzymes to determine specificity

    • Use proximity ligation assays to confirm E2-RNF222 interactions in cells

  • Chain-linkage analysis:

    • Determine the type of ubiquitin chains (K48, K63, etc.) formed by RNF222

    • Use linkage-specific antibodies or mass spectrometry approaches

    • This information will provide insights into the functional consequences of RNF222-mediated ubiquitination (degradation vs. signaling)

  • Dynamic ubiquitination studies:

    • Investigate how RNF222 activity responds to cellular stresses or signaling events

    • Utilize ubiquitin sensors to monitor ubiquitination dynamics in live cells

    • Examine how post-translational modifications of RNF222 affect its E3 ligase activity

These approaches have been successfully applied to characterize the ubiquitination networks of other RING finger proteins and would be valuable for understanding RNF222's role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.