Recombinant Human RING finger protein 223 (RNF223)

Shipped with Ice Packs
In Stock

Description

Role in Cancer Pathology: Focus on Pancreatic Cancer

RNF223 has emerged as a critical regulator in pancreatic cancer (PC) progression. Key findings from clinical and functional studies include:

Prognostic Significance

Clinical ParameterRNF223 Expression CorrelationP-ValueSource
Male GenderHigher expression in males<0.05
Alcohol ConsumptionElevated in high alcohol consumption groups<0.01
Tumor StageIncreased in stage IIa tumors<0.001

Functional Mechanisms in PC

In vitro studies using shRNA-mediated knockdown in ASPC-1 and PANC-1 cell lines demonstrated:

  • Reduced Proliferation: CCK8 assays showed >50% knockdown efficiency decreased cell viability .

  • Impaired Migration: Wound healing assays revealed diminished migratory capacity .

Proteomics Analysis
RNF223 knockdown in ASPC-1 cells enriched pathways related to:

PathwayEnrichmentBiological Impact
Oxidative PhosphorylationHighestAltered cellular metabolism
Cytoskeleton RegulationSignificantDisrupted cell migration
DNA SynthesisModerateImpaired replication processes

These findings suggest RNF223 promotes PC progression by modulating metabolic and cytoskeletal pathways .

Transcriptional Regulation

KLF4 (Krüppel-like factor 4) was identified as a transcriptional activator of RNF223 in PC. Luciferase assays confirmed KLF4 binding to RNF223 promoter regions, driving its overexpression .

Therapeutic Potential

RNF223’s role in PC metabolism and migration positions it as a candidate therapeutic target. Strategies include:

  1. RNA Interference: shRNA knockdown to suppress oncogenic functions .

  2. Small-Molecule Inhibitors: Targeting the RING domain to disrupt E3 ligase activity.

  3. Biomarker Development: Utilizing RNF223 expression levels for prognostic stratification.

Genetic Variants and Clinical Implications

The LOVD database reports a germline variant (g.1004331C>T) associated with RNF223, though functional impact remains uncharacterized . Further studies are needed to link genetic alterations to disease phenotypes.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.

Synonyms
RNF223; RING finger protein 223
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF223
Target Protein Sequence
MSSGQQVWHTAVPPPRRSSSIASMPRSPSSAGSPRSPGTPGSERVASPLECSICFSGYDN IFKTPKELSCTHVFCLECLARLAAAQPVGRPGGEAVPCPFCRQPTAVPPAGAPALCTSRQ LQARMPAHLRREEPVWLEGTKLCCQPLPTTPGREPGFVCVDVGLSKPAEPPAPARDPAPR RGRLARCWARCRDWRRMALVSALLLMLFCVALWPVQCALKTGNLRCLPLPPRPPATSTAA SPLGPLTDN
Uniprot No.

Target Background

Database Links

HGNC: 40020

KEGG: hsa:401934

UniGene: Hs.568137

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure of RNF223 and how does it function as an E3 ubiquitin ligase?

RNF223 belongs to the RING finger protein family, characterized by a cysteine-rich domain that coordinates zinc ions in a cross-brace topology. Like other RING finger proteins, RNF223 functions as an E3 ubiquitin ligase, facilitating the transfer of activated ubiquitin from ubiquitin-conjugating enzymes (E2) to protein substrates, thus conferring substrate specificity in the ubiquitination pathway .

The protein contains specific zinc-coordinating residues arranged in patterns that form functional zinc finger domains. The structural arrangement typically follows a C3HC4 or similar motif where cysteine and histidine residues bind zinc ions, creating a stable scaffold for protein interactions .

How is RNF223 expressed in normal human tissues versus cancer tissues?

Expression analysis using data from The Cancer Genome Atlas (TCGA) shows differential expression of RNF223 across normal and cancerous tissues. In pancreatic adenocarcinoma (PAAD), RNF223 demonstrates elevated expression compared to normal pancreatic tissue . The Human Protein Atlas provides comprehensive expression data showing variable RNF223 expression across different cancer types, with notable expression in certain types including pancreatic cancer .

To examine tissue-specific expression patterns, researchers typically employ:

  • RNA-Seq for transcriptome analysis

  • Immunohistochemistry for protein localization

  • qRT-PCR for quantitative expression assessment using primers such as:
    RNF223: 5′-TGATGCTCTTCTGTGTGGCA-3′ (Forward) and 5′-TTATCAGTCAGAGGCCCGAG-3′ (Reverse)

What is the prognostic significance of RNF223 in pancreatic cancer?

When analyzing survival data, researchers should:

  • Perform Kaplan-Meier survival analysis

  • Conduct univariate and multivariate Cox regression analyses

  • Calculate hazard ratios (HR) to quantify risk

  • Apply appropriate statistical thresholds (p<0.05)

How does RNF223 affect cellular functions in pancreatic cancer?

Functional studies using RNF223-targeting shRNA in pancreatic cancer cell lines (ASPC-1 and PANC-1) demonstrated that:

  • RNF223 knockdown significantly reduced cell proliferation as measured by CCK8 assay

  • RNF223 silencing decreased migration ability in wound healing assays

  • Mechanistically, RNF223 promotes cancer progression by regulating cellular metabolism

Experimental ApproachFindings in RNF223-silenced CellsMethodology
Cell ProliferationReduced cell numberCCK8 assay
Cell MigrationDecreased migration distanceWound healing assay
MechanismAltered metabolism-related pathwaysQuantitative proteomics

What methodologies are recommended for studying RNF223 in cancer models?

For comprehensive analysis of RNF223 in cancer research, the following methodological approaches are recommended:

  • Gene Expression Analysis:

    • RNA-seq for transcriptome profiling

    • qRT-PCR with appropriate housekeeping genes (e.g., GAPDH) for validation

    • ChIP sequencing to identify transcription factor binding (particularly KLF4)

  • Functional Assessment:

    • RNA interference (RNAi) using shRNAs with >50% knockdown efficiency

    • CRISPR-Cas9 genome editing for knockout studies

    • Rescue experiments with wild-type and mutant forms of RNF223

  • Protein Analysis:

    • Western blotting for protein expression

    • Immunoprecipitation for protein-protein interactions

    • Quantitative proteomics to identify downstream pathways affected by RNF223

How can researchers effectively study the E3 ligase activity of RNF223?

Studying the E3 ligase activity of RNF223 requires specialized biochemical approaches:

  • In vitro Ubiquitination Assays:

    • Requires purified recombinant RNF223, E1, E2 enzymes, ubiquitin, ATP, and potential substrates

    • Monitor ubiquitin chain formation using western blot or mass spectrometry

    • Employ ubiquitin mutants (K48R, K63R) to determine the type of ubiquitin chains formed

  • Substrate Identification:

    • Immunoprecipitation combined with mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • Global protein stability profiling following RNF223 manipulation

  • Structure-Function Analysis:

    • Generate point mutations in the RING domain to disrupt zinc coordination

    • Assess the impact on E3 ligase activity and cellular functions

    • Use structural prediction tools to model interactions with E2 enzymes

What is the relationship between KLF4 and RNF223 expression, and how can this be experimentally validated?

Research has shown that KLF4 contributes to the increased expression of RNF223 through transcriptional activation. To validate this relationship:

  • Transcriptional Regulation Analysis:

    • ChIP sequencing to confirm KLF4 binding to the RNF223 promoter

    • Luciferase reporter assays with wild-type and mutated RNF223 promoter constructs

    • EMSA (Electrophoretic Mobility Shift Assay) to directly assess KLF4 binding

  • Expression Correlation Studies:

    • Knockdown or overexpression of KLF4 followed by measurement of RNF223 expression

    • qRT-PCR using primers specific for KLF4 (5′-CCCACATGAAGCGACTTCCC-3′ (F) and 5′-CAGGTCCAGGAGATCGTTGAA-3′(R)) and RNF223

    • Co-expression analysis in patient samples

  • Functional Relevance:

    • Rescue experiments in KLF4-depleted cells by expressing RNF223

    • Assess impact on cell proliferation, migration, and metabolism-related pathways

How should a study protocol be designed to investigate RNF223 function in various cancer types?

Designing a robust study protocol for RNF223 requires careful consideration of several factors:

  • Study Objectives and Hypotheses:

    • Clearly define research questions regarding RNF223's role in specific cancer types

    • Formulate testable hypotheses based on preliminary data and literature review

  • Sample Selection and Controls:

    • Include appropriate cancer cell lines with varying RNF223 expression levels

    • Use patient-derived xenografts or organoids for greater clinical relevance

    • Include proper controls for genetic manipulation experiments (scrambled shRNA, empty vector)

  • Methodological Approaches:

    • Employ multi-omics approaches (genomics, transcriptomics, proteomics)

    • Plan for both in vitro and in vivo experiments to validate findings

    • Include technical replicates (minimum n=3) and biological replicates

  • Data Analysis Plan:

    • Pre-specify statistical methods and significance thresholds

    • Plan for subgroup analyses and potential confounding factors

    • Consider power calculations to ensure adequate sample sizes

What are the key considerations when developing recombinant RNF223 for functional studies?

When expressing and purifying recombinant RNF223 for functional studies:

  • Expression System Selection:

    • Bacterial systems (E. coli) for structural studies with proper folding considerations

    • Mammalian expression systems (HEK293, CHO cells) for functional studies requiring post-translational modifications

    • Insect cell systems (Sf9, Hi5) for intermediate complexity proteins

  • Construct Design:

    • Include appropriate tags for purification (His-tag, GST, MBP) that won't interfere with function

    • Consider solubility enhancement strategies (fusion partners, solubility tags)

    • Design domain-specific constructs to study individual functional elements

  • Protein Folding and Activity:

    • Ensure proper zinc incorporation for RING domain integrity

    • Validate proper folding using circular dichroism or thermal shift assays

    • Verify E3 ligase activity using in vitro ubiquitination assays

  • Storage and Stability:

    • Determine optimal buffer conditions (pH, salt concentration, reducing agents)

    • Assess protein stability under different storage conditions

    • Consider the addition of stabilizing agents (glycerol, zinc)

How can researchers overcome challenges in studying protein-protein interactions involving RNF223?

Studying RNF223 interactions presents several challenges that can be addressed through methodological refinements:

  • Transient Interaction Detection:

    • Use crosslinking approaches prior to immunoprecipitation

    • Employ proximity ligation assays for in situ detection

    • Consider label-transfer techniques for capturing fleeting interactions

  • Low Abundance of RNF223:

    • Optimize immunoprecipitation conditions with appropriate detergents

    • Use tandem affinity purification to improve specificity

    • Consider exogenous expression systems with inducible promoters

  • Substrate Identification:

    • Implement proteasome inhibitors to stabilize ubiquitinated substrates

    • Use ubiquitin remnant profiling (K-ε-GG) for direct substrate identification

    • Apply genetic screens (CRISPR) to identify functional interaction partners

What approaches can help reconcile contradictory findings regarding RNF223 function across different cancer types?

When facing contradictory results regarding RNF223 function:

  • Context-Dependent Analysis:

    • Examine tissue-specific differences in expression and function

    • Consider genetic background variations across cell lines and models

    • Investigate potential isoform-specific functions

  • Methodology Standardization:

    • Standardize experimental conditions across studies

    • Implement multiple complementary methodologies to validate findings

    • Use isogenic cell line models to minimize confounding variables

  • Integrate Multi-Omics Data:

    • Combine transcriptomic, proteomic, and metabolomic analyses

    • Analyze pathway alterations rather than individual genes/proteins

    • Apply systems biology approaches to understand context-dependent functions

  • Meta-analysis and Replication:

    • Conduct systematic reviews of available literature

    • Reproduce key experiments with identical conditions

    • Collaborate across laboratories to validate findings

What emerging technologies could advance our understanding of RNF223 biology?

Several cutting-edge technologies hold promise for RNF223 research:

  • CRISPR-Based Technologies:

    • CRISPR activation/interference for temporal control of RNF223 expression

    • Base editing for introducing specific mutations without double-strand breaks

    • CRISPR screens to identify synthetic lethal interactions with RNF223

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging with fluorescent tags for dynamic studies

    • Correlative light and electron microscopy for structural context

  • Single-Cell Technologies:

    • Single-cell RNA-seq to capture cell population heterogeneity

    • Single-cell proteomics for protein-level analysis

    • Spatial transcriptomics to understand tissue context

  • Structural Biology Approaches:

    • Cryo-EM for structure determination of RNF223 complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • AlphaFold or similar AI approaches for structural prediction

How might RNF223 research inform therapeutic strategies in cancer?

RNF223 research has several potential therapeutic implications:

  • Target Validation Strategies:

    • Genetic proof-of-concept studies using conditional knockouts

    • Pharmacologic inhibition through structure-based drug design

    • Identification of synthetic lethal interactions for combination approaches

  • Biomarker Development:

    • Validation of RNF223 as a prognostic biomarker across cancer types

    • Development of immunohistochemistry or liquid biopsy assays

    • Integration with other biomarkers for improved prediction models

  • Therapeutic Approaches:

    • Small molecule inhibitors targeting the RING domain

    • Degrader technologies (PROTACs) directed at RNF223

    • Targeting the KLF4-RNF223 axis through transcriptional inhibition

  • Patient Stratification:

    • Identification of patient subgroups likely to benefit from RNF223-targeted therapies

    • Combination strategies based on pathway analysis

    • Resistance mechanisms prediction and management

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.