Recombinant Human RING finger protein 24 (RNF24)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human RING Finger Protein 24 (RNF24)

Recombinant Human RING finger protein 24 (RNF24) is a protein that, in humans, is encoded by the RNF24 gene . RNF24 is involved in various cellular processes, including protein ubiquitination and intracellular trafficking . Studies suggest RNF24 interacts with TRPC cation channels in the Golgi apparatus, influencing their movement within the cell .

Basic Information of RNF24

Gene NameRNF24
Protein NameRING finger protein 24
OrganismHomo sapiens (Human)
FunctionAffects TRPC intracellular trafficking
Related PathwaysProtein ubiquitination, intracellular trafficking

RNF24 and Osteoporosis

Recent research has explored the role of RNF24 in osteoporosis (OP). One study utilized single-cell and RNA sequencing data to identify diagnostic genes for OP, noting that RNF24 expression was increased in monocytes in both mouse and human blood samples . Furthermore, the study found that anti-RNF24 partially alleviated the progression of osteoporosis in mice . These findings suggest RNF24's involvement in the pathogenesis of osteoporosis and its potential as a therapeutic target .

Methodology in Osteoporosis Study

To investigate the role of RNF24 in osteoporosis, researchers used a combination of single-cell RNA sequencing (scRNA-seq) and bulk RNA sequencing . The methodologies included:

  1. Weighted Gene Co-expression Network Analysis (WGCNA): Used to identify OP-associated genes by clustering specimens and determining the optimal soft threshold for network construction .

  2. Diagnostic Model Construction: Employed univariate logistic regression and LASSO regression analyses to identify hub genes, with ROC curves generated using the pROC package .

  3. Regulatory Network Construction: MicroRNAs (miRNAs) targeting hub genes were identified using the miRDB database, long noncoding RNAs (lncRNAs) were mined from the Starbase database, and transcription factors (TFs) were predicted via the Network Analyst database .

  4. Cellular Expression Analysis: The expression of hub genes in clustered cells was demonstrated using bubble and clustering maps, with differentiation trajectories simulated using the monocle package .

Quantitative Data Analysis

GeneCell TypeExpression Changep-value
RNF24MonocytesIncreased< 0.05
FAM129AGranulocytesDecreased< 0.05

p < 0.05 indicates statistical significance .

Genetic Association Studies

The All by All tables, available through the All of Us Researcher Workbench, include GWAS and RVAS results for thousands of phenotypes from approximately 250,000 participants with whole genome sequence data . These tables facilitate the exploration of genes or genetic variants contributing to specific phenotypes, offering time and cost savings for researchers . The All of Us Research Program enrolls participants of diverse ancestries, enhancing the potential for novel health discoveries in previously underrepresented groups .

Data Quality and Control

Stringent quality control measures were applied to ensure the reliability of the data. Only high-quality samples, genotypes, and variants were included in downstream analyses . Phenotypes with greater than 200 cases within each genetic ancestry group were included to ensure sufficient statistical power . In total, 6,664 high-quality ancestry group and phenotype pairs were included in the final data .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type for prioritized development.
Synonyms
RNF24; RING finger protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF24
Target Protein Sequence
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQGPLPGAENIV
Uniprot No.

Target Background

Function
May play a role in the intracellular trafficking of TRPC channels.
Gene References Into Functions
  1. RNF24 interacts with TRPC cation channels within the Golgi apparatus, influencing their intracellular trafficking without affecting channel activity. PMID: 17850865
Database Links

HGNC: 13779

OMIM: 612489

KEGG: hsa:11237

STRING: 9606.ENSP00000388550

UniGene: Hs.547576

Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.