Recombinant Human RING finger protein 26 (RNF26)

Shipped with Ice Packs
In Stock

Description

Immune Regulation via STING Pathway

  • Positive regulation: RNF26 stabilizes MITA/STING (mediator of IFN response) by promoting K11-linked ubiquitination, enhancing early-phase antiviral IFN-β production .

  • Negative regulation: Autophagy-dependent degradation of IRF3 limits prolonged IFN-β responses, balancing immune activation .

ER Membrane Organization

  • Forms a complex with TMEM43, TMEM33, and ENDOD1 to modulate ER-endolysosome contacts, influencing innate immune signaling .

  • Anchors perinuclear ER subdomains via vimentin interaction, critical for stress-induced ER remodeling .

Cancer Progression

  • Upregulation in tumors: Overexpressed in clear cell renal cell carcinoma (ccRCC) and bladder cancer, promoting proliferation via degradation of tumor suppressors (e.g., TSC1, CBX7) .

  • Therapeutic target: CDK4/6 inhibitors destabilize RNF26-TSC1 interactions, restoring mTOR pathway regulation in ccRCC .

Table 1: Functional Mechanisms of RNF26

MechanismTarget/PathwayBiological ImpactReference
K11 ubiquitinationMITA/STINGEnhances early IFN-β production
Autophagy degradationIRF3Limits late IFN-β responses
TSC1 ubiquitinationmTOR pathwayPromotes ccRCC progression
Vimentin bindingER-endolysosome contactsMaintains ER spatial organization

Therapeutic Implications

  • Antiviral strategies: Modulating RNF26 could fine-tune STING-dependent immunity against viruses like HSV-1 .

  • Cancer therapy: Combining CDK4/6 inhibitors (e.g., palbociclib) with mTOR inhibitors shows promise in RNF26-overexpressing ccRCC .

  • ER stress disorders: Targeting RNF26-vimentin interactions may alleviate pathologies linked to ERQC dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
RNF26; E3 ubiquitin-protein ligase RNF26; RING finger protein 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF26
Target Protein Sequence
MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRG VLLSLLALIEAVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVL NVVSSGHALLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVTGPLWRM TDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAV TVTVLHPDFTLRLATQALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASW PNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEE PPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPL CRRGILQTLNVYL
Uniprot No.

Target Background

Function
Recombinant Human RING finger protein 26 (RNF26) is an E3 ubiquitin-protein ligase crucial for endosome organization by retaining vesicles within the perinuclear cloud. It acts as a platform for perinuclear endosomal system positioning by ubiquitinating SQSTM1. Ubiquitinated SQSTM1 attracts specific vesicle-associated adapters, creating a molecular bridge that anchors cognate vesicles perinuclearly, thus organizing the endosomal pathway for efficient cargo transport. RNF26 also regulates type I interferon production in response to viral infection by mediating the formation of Lys-11-linked polyubiquitin chains on TMEM173/STING, stabilizing TMEM173/STING. Furthermore, it limits the type I interferon response by promoting the autophagic degradation of IRF3.
Gene References Into Functions
  1. A study identified the endoplasmic reticulum (ER)-located ubiquitin ligase Ring finger protein 26 (RNF26) as the overarching organizer of the entire endosomal system, including the trans-Golgi network. PMID: 27368102
Database Links

HGNC: 14646

OMIM: 606130

KEGG: hsa:79102

UniGene: Hs.524084

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Up-regulated in several cancer cell lines.

Q&A

What is RNF26 and what is its primary molecular function?

RNF26 is an endoplasmic reticulum (ER)-embedded E3 ubiquitin ligase that contains a RING finger domain, which mediates its ubiquitin ligase activity. Its primary functions include:

  • Mediating polyubiquitination of target proteins through its RING domain

  • Maintaining the integrity and organization of the perinuclear ER subdomain

  • Establishing membrane contact sites between the ER and endolysosomes

  • Regulating innate immune responses, particularly in virus-triggered type I interferon pathways

  • Contributing to cellular proteostasis during ER stress conditions

These functions collectively position RNF26 as a critical coordinator of organelle positioning, stress response, and immune signaling.

What is the domain structure of RNF26 and how does it relate to function?

RNF26 contains several key structural features that contribute to its diverse cellular roles:

  • Transmembrane segments that anchor it to the ER membrane

  • A soluble C-terminal fragment containing the catalytic RING domain (amino acids 304-433)

  • An atypical RING domain that coordinates zinc ions through conserved cysteine and histidine residues

  • A unique β-sheet at the C-terminus of the RING domain conserved across species

  • The last 10 residues (423-433) at the C-terminus are particularly important for vimentin interaction

The RING finger domain is essential for E2 binding and ubiquitin transfer activity, while the C-terminal region mediates critical protein-protein interactions that affect RNF26 localization and function.

Where is RNF26 localized within cells and how is this regulated?

RNF26 displays specific subcellular localization that is critical to its function:

  • Embedded in the ER membrane with preferential localization within the perinuclear ER subdomain

  • Associated with ER sheets, which are normally retained in the perinuclear region

  • Partially colocalized with vimentin intermediate filaments, particularly in its catalytically inactive form

  • Positioned to engage with vesicles of the endolysosomal system from its perinuclear vantage point

This localization is regulated by direct interaction with perinuclear vimentin intermediate filaments, which serve as anchors restricting RNF26 to the perinuclear ER segment. Notably, the catalytically inactive form of RNF26 (I382R) shows enhanced colocalization with vimentin structures compared to wild-type, suggesting that its catalytic state influences its spatial distribution .

How does RNF26 interact with vimentin intermediate filaments?

RNF26 interacts with vimentin through a specific mechanism that has been characterized through multiple complementary approaches:

MethodKey Findings
Co-immunoprecipitationVimentin identified among proteins coprecipitating with RNF26 RING domain
Proximity biotinylationVimentin found biotinylated in close proximity to RNF26 in cells
Direct binding assayRhodamine-labeled RING-I382R domain recovered by His-tagged vimentin
Filament bindingDeposition of labeled RING-I382R domain onto in vitro assembled vimentin filaments
Fluorescence polarizationConcentration-dependent binding of vimentin to RNF26 C-terminal peptide (aa 423-433)

This interaction is mediated by the C-terminal region of RNF26's RING domain (specifically the last 10 residues, amino acids 423-433). The binding is enhanced when RNF26 is in its catalytically inactive state (I382R mutant), which displays a pronounced filamentous distribution aligned to vimentin fibers when expressed in cells .

How does the RING domain of RNF26 facilitate E2 binding and ubiquitination?

The RING finger domain of RNF26 follows similar mechanisms to other RING E3 ligases:

  • Coordinates zinc ions through conserved cysteine and histidine residues

  • Creates a binding surface for ubiquitin-conjugating enzymes (E2s)

  • Facilitates transfer of ubiquitin from E2 to substrate proteins

  • Functions independently in vitro when purified and combined with E1 and E2 enzymes

  • Mutations of metal-coordinating residues or chelation of zinc abolish ubiquitination activity

In cells, wild-type RNF26, but not RING-mutated forms, co-immunoprecipitates with endogenous E2s recognized by anti-UbcH5B antibodies. This interaction is essential for RNF26's ubiquitin ligase activity, which can be observed as higher molecular weight species in immunoblots corresponding to ubiquitinated forms of RNF26 itself .

How does RNF26 contribute to ER organization and homeostasis?

RNF26 plays multiple roles in maintaining ER architecture and function:

  • Maintains the integrity of the perinuclear ER subdomain and influences ER membrane dynamics

  • Controls the spatial distribution of ER sheets, keeping them primarily in the perinuclear area

  • Promotes perinuclear coalescence of the ER quality control compartment (ERQC) during proteotoxic stress

  • Facilitates juxtaposition of biosynthetic and proteolytic compartments for efficient recovery from ER stress

Loss of RNF26 leads to disturbed ER organization, with diminished concentration of ER membranes in the perinuclear region, enhanced motility of the perinuclear ER segment, and spreading of ER sheets into the cell periphery. These architectural changes coincide with elevation in basal ER stress, as evidenced by increased XBP1 splicing in RNF26-depleted cells .

What is the role of RNF26 in coordinating ER-endolysosomal interactions?

RNF26 serves as a critical coordinator between the ER and endolysosomal system:

  • Functions as a physical link between perinuclear ER subdomains and endolysosomes

  • Establishes membrane contact sites (MCS) between these compartments

  • Enables spatial retention of endolysosomes in perinuclear space through RNF26-mediated MCS

  • Drives acute perinuclear coalescence of ER with endolysosomes under proteotoxic stress conditions

  • Facilitates efficient recovery from ER stress via the Sec62-mediated ER-phagy pathway

Through these actions, RNF26 creates a scaffolding mechanism for spatiotemporal integration of organelles during cellular proteostasis, particularly important during stress conditions when degradative and biosynthetic compartments need to be juxtaposed for efficient protein quality control.

How does RNF26 regulate innate immune signaling through MITA/STING?

RNF26 temporally regulates innate immune signaling through precise ubiquitination:

FeatureRNF26RNF5 (Another E3 ligase)
Ubiquitin linkage typeK11-linkedK48-linked
Target residue on MITA/STINGLysine 150Lysine 150
Effect on MITA/STINGProtection from degradationPromotes degradation
Effect on early IFN responseEnhancesSuppresses
Effect on late IFN responseSuppresses through IRF3 degradationUnknown

RNF26 regulates innate immune signaling by:

  • Mediating K11-linked polyubiquitination of MITA/STING at lysine 150

  • Protecting MITA from RNF5-mediated K48-linked polyubiquitination and degradation

  • Enabling efficient type I IFN and proinflammatory cytokine induction after viral infection

  • Later limiting excessive type I IFN response by promoting autophagic degradation of IRF3

This dual regulation creates a temporally controlled antiviral response that is initially robust but later contained to prevent harmful excessive inflammation.

What are the best approaches for studying RNF26 ubiquitination targets?

To effectively study RNF26 ubiquitination targets, researchers should consider these methodological approaches:

  • Expression screens to identify potential substrates (as used to identify MITA/STING)

  • Proximity biotinylation techniques to identify proteins in close proximity to RNF26 in cells

  • Purified protein systems using recombinant E1, E2, and RNF26 to test direct ubiquitination in vitro

  • Mutation of catalytic residues in the RING domain (e.g., I382R) to create inactive controls

  • Cell-based ubiquitination assays comparing wild-type and RING-mutated RNF26

  • Analysis of ubiquitin chain types (K11 vs K48 linkages) using linkage-specific antibodies

When designing these experiments, it's critical to include appropriate controls for ubiquitination specificity, such as RING domain mutants and zinc chelation treatments, as these can distinguish between specific and non-specific ubiquitination events.

How can researchers effectively manipulate RNF26 function in experimental settings?

Several approaches are available for manipulating RNF26 function in cellular systems:

  • Genetic approaches:

    • RNF26 knockdown using siRNA or shRNA

    • Complete knockout using CRISPR/Cas9

    • Expression of wild-type or mutant forms

  • Key mutations for functional studies:

    • I382R: Catalytically inactive form that maintains vimentin binding

    • C-terminal deletion (∆423-433): Disrupts vimentin interaction

    • Cation-coordinating residue mutations: Abolish ubiquitination activity

  • Zinc chelation treatments can be used to disrupt RING finger function

  • Fluorescent tagging (e.g., mCherry, GFP) for visualization of localization and dynamics

  • HA-tagging for immunoprecipitation and western blot detection

When interpreting results, researchers should consider that loss of RNF26 affects multiple cellular processes, including ER organization, endolysosomal positioning, and immune signaling pathways.

What phenotypic assays are most informative when studying RNF26 function?

The following phenotypic assays provide valuable insights into RNF26 function:

Cellular ParameterAssessment MethodExpected Phenotype with RNF26 Depletion
ER perinuclearityPerinuclearity coefficient analysisDecreased perinuclear concentration
ER sheet distributionFluorescence microscopy (mCherry-KDEL or VAP-A)Spread from perinuclear region to periphery
ER membrane dynamicsLive cell imagingEnhanced motility of perinuclear ER
ER stress levelsXBP1 splicing assayIncreased basal splicing
Antiviral responseIFNB1 gene expression over time courseDecreased early, increased late
Viral replicationViral titer or reporter assaysInhibited replication
Endolysosomal positioningImmunofluorescence of lysosomal markersAltered perinuclear clustering

These assays should be performed with appropriate controls and time-course analyses to capture the dynamic and context-dependent functions of RNF26 .

How do different mutations in the RNF26 RING domain affect its various functions?

Different mutations in the RNF26 RING domain have distinct functional consequences:

Mutation TypeEffect on UbiquitinationEffect on Vimentin BindingEffect on E2 BindingEffect on Cellular Localization
I382RAbolishes catalytic activityEnhances vimentin bindingMaintains E2 bindingIncreased filamentous distribution with vimentin
C-terminal ∆10 (∆423-433)MaintainedAbrogated vimentin interactionLikely maintainedAltered perinuclear localization
Cysteine/histidine coordination mutationsAbolishes ubiquitinationUnknownDisruptedLikely altered
Zinc chelationAbolishes ubiquitinationMay disruptDisruptedUnknown

These differential effects highlight the multifunctional nature of the RING domain, with separable regions mediating E2 binding, catalytic activity, and vimentin interaction. The I382R mutation is particularly useful for research as it separates catalytic activity from structural scaffolding functions .

What are the temporal dynamics of RNF26's role in antiviral responses?

RNF26 exhibits complex temporal regulation in antiviral responses:

This temporal switching of RNF26 function highlights its sophisticated role in immune regulation and suggests potential therapeutic implications for viral infections.

What are the consequences of RNF26 dysregulation in cellular stress responses?

RNF26 dysregulation has significant consequences for cellular stress responses:

These findings suggest that RNF26 functions as a stress-responsive factor that helps coordinate the physical reorganization of cellular components necessary for effective stress responses. Its loss compromises the cell's ability to adapt to and recover from proteotoxic challenges.

How might the study of RNF26 contribute to understanding disease mechanisms?

Research on RNF26 has potential implications for various disease mechanisms:

  • Viral infections and innate immunity:

    • RNF26's temporal regulation of type I interferon responses directly impacts viral defense

    • Understanding this regulation could reveal new therapeutic targets for viral infections

    • The balance between early activation and late suppression of immune signaling may be crucial in preventing immunopathology

  • Protein misfolding diseases:

    • RNF26's role in ER quality control and stress responses connects to diseases involving protein misfolding

    • Its contribution to ER-phagy pathways suggests potential involvement in neurodegenerative diseases where proteostasis is compromised

  • Cancer biology:

    • The interaction with vimentin, which is often upregulated in epithelial-mesenchymal transition, suggests possible roles in cancer progression

    • Altered ER organization and stress responses are features of many cancer cells

Future research exploring connections between RNF26 dysfunction and these disease mechanisms could yield valuable insights for therapeutic development.

What technical challenges remain in studying RNF26 and how might they be addressed?

Several technical challenges exist in RNF26 research:

  • Specificity of ubiquitination targets:

    • Challenge: Identifying the complete set of physiological substrates

    • Solution: Combine proximity labeling with ubiquitinome analysis; develop substrate-trapping mutants

  • Dynamic regulation during stress responses:

    • Challenge: Capturing rapid temporal changes in RNF26 activity and localization

    • Solution: Live-cell imaging with optogenetic tools to monitor and manipulate RNF26 in real-time

  • Structural analysis:

    • Challenge: Obtaining structural information for membrane-embedded RNF26

    • Solution: Cryo-EM approaches for membrane proteins; structural analysis of soluble domains

  • Physiological relevance:

    • Challenge: Translating cellular findings to tissue and organismal contexts

    • Solution: Development of tissue-specific knockout models; analysis in primary cells

Addressing these challenges will require interdisciplinary approaches combining biochemistry, cell biology, structural biology, and advanced imaging techniques.

How does RNF26 compare to other ER-resident RING finger ubiquitin ligases?

RNF26 shares features with other ER-resident RING finger ligases but also has unique characteristics:

  • Similarities with other ER-resident E3 ligases:

    • Contains transmembrane domains for ER embedding

    • Utilizes RING domain for E2 binding and ubiquitin transfer

    • Participates in protein quality control pathways

  • Unique features of RNF26:

    • Direct interaction with vimentin intermediate filaments

    • Roles in organizing perinuclear ER architecture

    • Temporal regulation of innate immune signaling

    • Coordination of ER-endolysosomal membrane contact sites

  • Functional overlap with RNF5:

    • Both target the same lysine residue (K150) on MITA/STING

    • RNF26 promotes K11-linked chains while RNF5 promotes K48-linked chains

    • They have opposing effects on MITA/STING stability and immune signaling

These comparisons highlight the specialized functions of RNF26 within the broader context of ER-resident ubiquitin ligases and suggest coordination between different E3s in regulating shared pathways through distinct ubiquitination patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.