Recombinant Human RPE-retinal G protein-coupled receptor (RGR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human RPE-retinal G Protein-Coupled Receptor (RGR)

Recombinant Human RPE-retinal G protein-coupled receptor (RGR) is a bioengineered form of the RGR protein, a member of the opsin family of G protein-coupled receptors (GPCRs). It is primarily expressed in the retinal pigment epithelium (RPE) and Müller glia, where it participates in the visual cycle by regenerating 11-cis-retinal, a critical chromophore for visual pigments like rhodopsin .

Recombinant RGR Production and Expression Systems

Recombinant RGR is produced using advanced gene delivery systems to ensure functional expression:

MethodKey Findings
Lentiviral VectorsHigh expression in ARPE-19 RPE cells; stable for >6 months
COS-7 Cell TransfectionLower expression compared to ARPE-19 cells
Biochemical AssaysBinds [³H]-all-trans-retinal with specificity; CRALBP enhances activity

Lentiviral systems achieve 100-fold higher RGR levels in RPE cells, enabling studies of retinoid metabolism and light-dependent isomerization .

Role in the Visual Cycle

RGR collaborates with retinoid dehydrogenases (e.g., RDH5) and CRALBP to regenerate 11-cis-retinal:

  1. Light-Dependent Activity: RGR-bound all-trans-retinal is photoisomerized to 11-cis-retinal, which is stabilized by CRALBP .

  2. Non-Essential but Supportive Role: RGR knockout mice show mild deficits in rhodopsin regeneration, with elevated all-trans-retinyl esters .

Interaction with Retinoid Metabolism Enzymes

EnzymeInteraction
LRATCompetes with RGR for all-trans-retinol substrates
RDH5Oxidizes all-trans-retinol to all-trans-retinal for RGR activity

Clinical Relevance

Mutations in RGR (e.g., Ser66Arg, Gly2751 insertion) are linked to autosomal recessive and dominant retinitis pigmentosa .

Biochemical Studies

Recombinant RGR enables:

  • Chromophore Binding Assays: Quantification of all-trans-retinal binding kinetics .

  • Photoisomerization Dynamics: Analysis of light-dependent 11-cis-retinal production .

Therapeutic Potential

ApplicationMechanism
Retinal DiseasesGene therapy for RGR-associated retinitis pigmentosa
Skin DisordersRGR’s role in keratinocyte proliferation and apoptosis (emerging evidence)

Clinical and Experimental Challenges

  • Low Basal Activity: Early studies underestimated RGR’s photoisomerization due to suboptimal assay conditions .

  • Isoform Complexity: Alternative splicing produces distinct RGR variants (e.g., RGR-d), complicating functional analysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it for you.
Synonyms
RGR; RPE-retinal G protein-coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RGR
Target Protein Sequence
MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLAL ADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTR SQLAWNSAVSLVLFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTM SFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVIADVT SISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK
Uniprot No.

Target Background

Function
This protein acts as a receptor for both all-trans- and 11-cis-retinal. It exhibits preferential binding to all-trans-retinal and may catalyze the isomerization of the chromophore through a retinochrome-like mechanism.
Gene References Into Functions
  1. Research indicates that the cone photoreceptors of humans and cattle express a nonvisual opsin belonging to the Go/RGR or tetraopsin group. PMID: 30034210
  2. A study aimed at systematically analyzing the potential role of RGR variants in retinal diseases suggested that heterozygous truncation variants in RGR are less likely to be pathogenic. PMID: 27748892
  3. The E150K opsin partially colocalizes with the cis/medial Golgi compartment but not with the trans-Golgi network. The findings are consistent with a recessive pattern of inheritance. Retinal degeneration is attributed to deficient opsin export from the Golgi. PMID: 16737970
  4. These results demonstrate that after exon-skipping RGR splice isoform (RGR-d) is synthesized, the RGR-d epitope is released at the basal surface of the retinal pigment epithelium and deposited into Bruch's membrane in human eyes throughout adulthood. PMID: 17679941
  5. RGR-opsin mediates light-dependent translocation of all-trans-retinyl esters from a storage pool in lipid droplets to an "isomerase pool" in membranes of the endoplasmic reticulum. PMID: 18474598
  6. The exon-skipping variant of RGR (RGR-d) is found in extracellular deposits at the base of early-stage drusen mounds in older donors and may precede the formation of these drusen. PMID: 19450444

Show More

Hide All

Database Links

HGNC: 9990

OMIM: 600342

KEGG: hsa:5995

STRING: 9606.ENSP00000352427

UniGene: Hs.1544

Involvement In Disease
Retinitis pigmentosa 44 (RP44)
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina.

Q&A

What is the molecular structure of RGR and how does it differ from other G protein-coupled receptors?

To study RGR structure, researchers should employ multiple complementary approaches:

  • Sequence analysis reveals seven transmembrane domains characteristic of GPCRs

  • Homology modeling based on rhodopsin crystal structures provides initial structural insights

  • Spectroscopic analysis of purified recombinant RGR characterizes the retinal binding pocket

  • Mutagenesis studies targeting conserved residues help identify functional domains

The primary functional difference between RGR and visual opsins is the direction of their photochemistry - while rhodopsin converts 11-cis-retinal to all-trans-retinal upon light absorption, RGR performs the reverse reaction, converting all-trans-retinal to 11-cis-retinal .

What are the optimal expression systems for producing functional recombinant human RGR?

Producing functional recombinant human RGR requires careful selection of expression systems and conditions:

  • Mammalian cell lines (HEK293, COS-7) provide appropriate post-translational modifications but lower yields

  • Insect cell systems (Sf9/Sf21) offer a balance between yield and proper protein folding

  • Bacterial systems typically require extensive refolding protocols

Key methodological considerations include:

  • The addition of all-trans-retinal during expression enhances protein stability

  • Reduced expression temperature (16-20°C) improves proper folding

  • C-terminal rather than N-terminal affinity tags minimize interference with retinal binding

  • Mild detergents (DDM, LMNG) with cholesterol supplementation improve extraction efficiency

For functional studies, reconstitution into lipid nanodiscs or proteoliposomes generally preserves activity better than detergent micelles .

How can researchers verify the identity and purity of recombinant RGR preparations?

Multiple analytical techniques should be employed to verify recombinant RGR identity and purity:

  • SDS-PAGE and Western blotting using validated anti-RGR antibodies

    • Expected molecular weight: approximately 25-30 kDa

    • Multiple bands may indicate degradation or aggregation

  • Spectroscopic analysis

    • Characteristic absorption maximum at 469-470 nm when bound to all-trans-retinal

    • Light-induced spectral shifts confirming photochemical activity

  • Mass spectrometry

    • Peptide mass fingerprinting for protein identification

    • Intact mass analysis to verify post-translational modifications

  • Size-exclusion chromatography to assess monodispersity and aggregation state

  • Functional validation through photoisomerase activity assays

    • HPLC-based detection of 11-cis-retinal formation upon light exposure

    • Enhanced activity in the presence of CRALBP

How do researchers quantitatively assess the photoisomerase activity of recombinant RGR?

Quantitative assessment of RGR photoisomerase activity requires specialized methodologies:

  • HPLC-based retinoid analysis:

    • Incubate purified RGR (0.5-1 μM) with all-trans-retinal (5-10 μM) under controlled illumination

    • Extract retinoids using organic solvents (hexane/ethyl acetate)

    • Analyze using reverse-phase HPLC with UV detection at 325-350 nm

    • Quantify 11-cis-retinal formation relative to initial all-trans-retinal

  • Critical experimental parameters:

    • Light wavelength (optimal: 470-490 nm)

    • CRALBP presence (increases 11-cis-retinal yield ~3.5-fold)

    • Temperature (typically 25-30°C)

    • pH range (optimal: 6.5-7.5)

  • Controls and validations:

    • Light-dependent and protein-dependent controls

    • Comparison with retinal isomerization in the absence of protein

    • Authentication of retinoid isomers using standards and UV spectroscopy

The most robust activity assay includes CRALBP as an 11-cis-retinal acceptor, as this protein has been shown to significantly enhance the observable photoisomerase activity of RGR by protecting the formed 11-cis-retinal from re-isomerization .

What is the mechanistic basis for RGR's interaction with binding partners in the retinoid cycle?

RGR functions within a multi-protein complex that facilitates retinoid processing in the RPE:

  • RGR-CRALBP interaction:

    • CRALBP acts as an acceptor for 11-cis-retinal produced by RGR

    • This interaction increases photoisomerase activity ~3.5-fold

    • CRALBP binds 11-cis-retinal and protects it from re-isomerization

  • RGR-RDH5 coupling:

    • RDH5 (11-cis-retinol dehydrogenase) forms a functional complex with RGR

    • This coupling enables complete photoisomerization through reduction of 11-cis-retinal to 11-cis-retinol

    • The reductase activity depends on NADH availability

  • RGR-RPE65 interaction:

    • Immunoprecipitation studies indicate RPE65 interacts directly with RGR

    • This interaction may coordinate enzymatic and photochemical isomerization pathways

    • CRALBP, RDH5, RPE65, and RGR co-precipitate as a functional complex

These interactions suggest the formation of a retinoid processing metabolon that enhances efficiency through substrate channeling between enzymes .

How do mutations in the RGR gene affect protein function and contribute to retinal diseases?

Several pathogenic mutations in the RGR gene have been identified in patients with retinitis pigmentosa:

  • The Ser66Arg missense mutation:

    • Results in recessive inheritance pattern of retinitis pigmentosa

    • Likely disrupts normal protein folding or retinal binding

  • The Gly275 1-bp insertion:

    • Associated with dominant retinitis pigmentosa

    • Creates a frameshift resulting in a truncated protein

    • May exert a dominant negative effect by interfering with wild-type RGR function

    • Could disrupt potential RGR multimeric organization

To study these mutations experimentally:

  • Generate recombinant proteins with specific mutations

  • Assess protein stability, folding, and retinal binding capacity

  • Measure photoisomerase activity of mutant proteins

  • Evaluate cellular localization and protein-protein interactions

  • Create knockin animal models to assess physiological consequences

The dominant inheritance pattern observed with the frameshift mutation suggests RGR may function as a multimer, as proposed for other GPCRs .

What insights have knockout mouse models provided about RGR function in the retinoid cycle?

Studies using rgr−/− knockout mice have revealed several important phenotypes:

  • Light-dependent retinoid abnormalities:

    • Formation of 9-cis- and 13-cis-retinoid isomers after light exposure (not observed in wild-type mice)

    • These isomers likely form because all-trans-retinal is not bound to RGR, making it susceptible to non-specific isomerization

  • Altered retinoid metabolism after intense bleaching:

    • Transient accumulation of all-trans-retinyl esters

    • Attenuated recovery of 11-cis-retinal

    • These changes suggest RGR facilitates the utilization of all-trans-retinoids for regeneration of visual pigments

  • Double knockout findings:

    • rdh5−/−rgr−/− double knockout mice exhibit a phenotype similar to rdh5−/− mice

    • Both show high accumulation of cis-retinyl esters

    • This suggests functional relationships between RGR and RDH5 in retinoid processing

  • Quantitative retinoid differences:

    • rgr−/− mice show normal levels of 11-cis-retinal (530 ± 97 pmol/eye)

    • Elevated all-trans-retinyl esters (103 ± 29 pmol/eye versus WT 28.5 ± 13)

    • Increased 13-cis-retinyl esters (30 ± 13 pmol/eye versus almost undetectable in WT)

These findings indicate that while RGR contributes to efficient retinoid processing, its function is not essential for visual pigment regeneration in rod-dominated mice.

How should researchers design experiments to study light-dependent functions of RGR?

Studying the light-dependent functions of RGR requires careful experimental design:

  • Light source considerations:

    • Use monochromatic light sources with peak emission at 470-490 nm (RGR absorption maximum)

    • Calibrate light intensity carefully (1-5 mW/cm²) using a radiometer

    • Include dark controls for all experiments

  • Sample handling precautions:

    • Collect tissues under dim red light (>600 nm) to prevent uncontrolled photoisomerization

    • Use light-tight containers for sample transportation

    • Prepare all reagents in advance to minimize light exposure during experiments

  • Specialized experimental protocols:

    • For in vitro studies, compare activity under various light intensities and wavelengths

    • For in vivo studies, use controlled light exposure regimens and dark adaptation

    • Implement time-course studies to capture transient retinoid changes

  • Advanced analytical techniques:

    • Time-resolved spectroscopy to capture photocycle intermediates

    • Pulsed light experiments to measure reaction kinetics

    • State-specific crosslinking to trap interaction partners during the photocycle

A useful experimental paradigm involves comparing retinoid profiles in wild-type and rgr−/− mice after defined light exposures (single flash, continuous illumination, or intense bleaching) followed by various dark adaptation periods.

What is the evidence for RGR expression in non-retinal tissues and how should researchers investigate its function there?

Recent research has identified RGR expression in human skin cells:

  • Expression evidence:

    • Immunohistochemical staining detects RGR in keratinocytes, melanocytes, and fibroblasts

    • Western blotting confirms protein expression in these cell types

    • Subcellular localization can be determined using immunofluorescence and immunoelectron microscopy

  • Experimental approaches for functional investigation:

    • siRNA knockdown to assess effects on cellular functions (proliferation, migration, apoptosis)

    • Response to UV radiation in the presence or absence of all-trans-retinal

    • Changes in RGR expression under pathological conditions (psoriasis, seborrheic keratosis, squamous cell carcinoma)

  • Methodological considerations:

    • Validate antibody specificity using appropriate controls

    • Consider the impact of light conditions during experimental procedures

    • Evaluate whether skin-expressed RGR retains photoisomerase activity

To determine whether skin-expressed RGR maintains similar functionality to retinal RGR, researchers should isolate the protein from skin cells and assess its ability to bind retinoids and perform photoisomerization under controlled light conditions.

What are the most common technical challenges in RGR research and how can they be overcome?

Researchers working with RGR face several technical challenges:

  • Protein stability issues:

    • Challenge: RGR tends to aggregate and lose retinal during purification

    • Solution: Include all-trans-retinal (5-10 μM) throughout purification

    • Solution: Use milder detergents (LMNG, GDN) supplemented with cholesterol

    • Solution: Incorporate 10-20% glycerol in all buffers

  • Low photoisomerase activity detection:

    • Challenge: In vitro activity appears lower than expected from physiological role

    • Solution: Include CRALBP as an 11-cis-retinal acceptor (increases activity ~3.5-fold)

    • Solution: Optimize light conditions (wavelength: 470-490 nm)

    • Solution: Use highly sensitive HPLC methods with fluorescence detection

  • Retinoid handling complications:

    • Challenge: Retinoids are light-sensitive, hydrophobic, and prone to oxidation

    • Solution: Conduct experiments under dim red light

    • Solution: Include antioxidants (BHT, ascorbate) in all buffers

    • Solution: Use amber vials and nitrogen-purged solvents

  • Complex formation assessment:

    • Challenge: Transient protein-protein interactions are difficult to capture

    • Solution: Use chemical crosslinking followed by mass spectrometry

    • Solution: Employ FRET-based approaches with labeled proteins

    • Solution: Reconstitute minimal functional complexes in defined liposomes

What analytical methods provide the most reliable results for retinoid quantification in RGR research?

Accurate retinoid quantification is crucial for RGR functional studies:

  • Sample preparation protocol:

    • Harvest tissues under dim red light

    • Homogenize in PBS with antioxidants (BHT)

    • Extract with organic solvents (methanol followed by hexane/dichloromethane)

    • Evaporate under nitrogen and reconstitute in HPLC mobile phase

  • HPLC analysis optimization:

    • Normal-phase system for separation of geometric isomers

    • Silica or amino-based columns (3-5 μm particle size)

    • Mobile phase: Hexane with 0.1-1% dioxane or ethyl acetate

    • Detection: UV absorbance at 325-350 nm

    • Temperature control (20-25°C) for reproducible retention times

  • Identification and quantification approaches:

    • Compare with authentic standards for each retinoid isomer

    • Use on-line UV spectroscopy for peak verification

    • Employ mass spectrometry for unambiguous identification

    • Include internal standards for quantitative analysis

  • Data analysis considerations:

    • Integrate peak areas for quantification

    • Normalize to tissue weight or protein content

    • Use appropriate statistical analysis methods

Retinoid SpeciesTypical Amounts in Mouse Eye (WT)Amounts in rgr−/− Mouse EyeDetection Wavelength
11-cis-retinal500-600 pmol/eye530 ± 97 pmol/eye325 nm
All-trans-retinyl esters28.5 ± 13 pmol/eye103 ± 29 pmol/eye325 nm
13-cis-retinyl estersAlmost undetectable30 ± 13 pmol/eye325 nm

How should researchers interpret contradictory findings in the RGR literature?

The scientific literature contains some apparently contradictory findings regarding RGR function:

  • Photoisomerase activity discrepancies:

    • Some studies report low photoisomerase activity while others show robust activity

    • Resolution: The presence of CRALBP increases activity ~3.5-fold

    • Resolution: Specific wavelengths (470-490 nm) are required for optimal activity

    • Methodological approach: Directly compare experimental conditions focusing on light parameters and binding partners

  • Physiological relevance questions:

    • The low quantum efficiency, low abundance, and position behind photoreceptors question RGR's in vivo efficiency

    • Resolution: RGR likely functions as part of a larger complex that enhances its efficiency

    • Resolution: The rgr−/− phenotype becomes more apparent under specific light conditions

    • Methodological approach: Study rgr−/− mice under various light regimens to reveal condition-specific phenotypes

  • Interaction partner contradictions:

    • Different studies report varying sets of RGR binding partners

    • Resolution: Interactions may be transient or condition-dependent

    • Resolution: Different extraction methods may disrupt specific interactions

    • Methodological approach: Use multiple complementary techniques (co-IP, crosslinking, FRET) to validate interactions

When confronted with contradictory findings, researchers should carefully examine experimental conditions, particularly light parameters, sample preparation methods, and the presence of potential binding partners.

What are the most promising approaches for developing RGR-based tools for vision research?

Developing RGR-based research tools offers several promising directions:

  • Engineered RGR variants:

    • Create RGR variants with enhanced photoisomerase activity through directed evolution

    • Develop spectrally-shifted RGR variants for specific wavelength sensitivity

    • Generate constitutively active RGR mutants that continuously produce 11-cis-retinal

  • Optogenetic applications:

    • Couple RGR photoisomerase activity to other cellular processes

    • Create light-controlled 11-cis-retinal production systems for studying retinoid signaling

    • Develop RGR-based reporters for retinoid cycle dynamics

  • Therapeutic strategies:

    • Evaluate recombinant RGR supplementation for retinal diseases with impaired chromophore regeneration

    • Design small molecules that mimic or enhance RGR activity

    • Explore gene therapy approaches for RGR-associated retinal diseases

The coupling of RGR with fluorescent proteins or other readout systems could provide valuable tools for studying retinoid metabolism in live cells under various conditions.

How might systems biology approaches advance our understanding of RGR in the retinoid cycle?

Systems biology approaches offer powerful frameworks for understanding RGR's role:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and rgr−/− models

    • Map the impact of RGR on the broader retinoid metabolic network

    • Identify compensatory mechanisms in rgr−/− animals

  • Mathematical modeling:

    • Develop kinetic models of the retinoid cycle incorporating RGR activity

    • Simulate the impact of light conditions on retinoid metabolism

    • Predict the effects of RGR mutations on visual chromophore regeneration

  • Network analysis:

    • Map protein-protein interaction networks centered on RGR

    • Identify hub proteins that might coordinate RGR activity with other cellular processes

    • Compare retinoid processing networks across species with different visual systems

  • Single-cell approaches:

    • Analyze cell-type specific expression and activity of RGR

    • Investigate heterogeneity in RGR expression within the RPE

    • Study the co-expression patterns of RGR and its binding partners

These approaches could help reconcile the apparently modest phenotype of rgr−/− mice with the proposed important role of RGR in retinoid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.