Recombinant Human S-adenosylmethionine mitochondrial carrier protein (SLC25A26)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

SLC25A26 (Solute Carrier Family 25 Member 26) is a mitochondrial inner membrane protein that facilitates the countertransport of S-adenosylmethionine (SAM) and S-adenosylhomocysteine (SAH). It is the sole known transporter for SAM into mitochondria, where SAM serves as the primary methyl donor for mitochondrial methylation reactions, including RNA modification, protein synthesis, and the biosynthesis of electron carriers like coenzyme Q10 (CoQ10) and lipoic acid (LA) .

Key Features

ParameterDetails
Gene LocationChromosome 3p14.1 (autosomal recessive)
Protein StructureFull-length: 274 amino acids; three conserved repeats (~100 aa each)
Mitochondrial RoleSAM import ↔ SAH export; critical for mitochondrial methylation and OXPHOS

Mitochondrial Transport and Disease

Pathogenic SLC25A26 variants disrupt SAM/SAH exchange, leading to mitochondrial dysfunction and combined oxidative phosphorylation deficiency (COXPD28) .

Clinical Phenotypes

PhenotypeNeonatal/Early-Onset CasesAdult-Late-Onset Cases
Primary DefectSAM import deficiency SAH export deficiency
SymptomsNeonatal lactic acidosis, cardiopulmonary failureExercise intolerance, episodic metabolic decompensation
Biochemical Markers↓ Mitochondrial SAM, ↓ CoQ10, ↓ LA↑ Mitochondrial SAH, ↓ mtDNA methylation

Sources:

Role in Cancer and Immune Regulation

SLC25A26 expression impacts cancer cell metabolism and immune evasion:

  • Cancer Progression:

    • Overexpression: ↑ Mitochondrial SAM → ↓ cytoplasmic SAM → ↓ methionine cycle activity → ↑ ROS, ↓ GSH → Chemotherapy sensitivity .

    • Hypomethylation: ↓ Mitochondrial SAM → ↓ mtDNA methylation → ↑ Respiratory complex expression, ↑ ATP production → Tumor survival .

  • Immune Modulation: SLC25A26 may regulate immune cell infiltration in tumors via SAM-dependent epigenetic mechanisms .

Cardiac Function and Hypertrophy

SLC25A26 is enriched in cardiomyocytes, where it regulates SAM compartmentalization:

  1. Cytoplasmic SAM: Limits tRNA m¹A modifications (e.g., A58, A75), decelerating translation initiation .

  2. Mitochondrial SAM: Maintains mtDNA methylation, mitochondrial fission, and mitophagy for bioenergetic homeostasis .

  • Therapeutic Potential: Overexpression rescues cardiac hypertrophy and heart failure in mouse models .

Model Systems

ModelFindings
Drosophila melanogasterLarval developmental defects mimic human mitochondrial disease
Mouse CardiomyocytesSlc25a26 knockout → Spontaneous heart failure; overexpression → Hypertrophy rescue

Emerging Therapies

  • Gene Therapy: Cardiac-specific SLC25A26 overexpression reverses hypertrophy and fibrosis .

  • Small-Molecule Modulators: Targeting SAM/SAH transport or methylation-dependent pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A26; SAMC; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A26
Target Protein Sequence
MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGS FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Specifically, SLC25A26 mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Gene References Into Functions
  1. Overexpression of SLC25A26 in CaSki cells increases mitochondrial SAM availability and promotes hypermethylation of mitochondrial DNA, leading to decreased expression of key respiratory complex subunits, reduced mitochondrial ATP production, and release of cytochrome c. PMID: 28118529
  2. Mutations in SLC25A26 can cause various mitochondrial defects, including those affecting RNA stability, protein modification, mitochondrial translation, and the biosynthesis of CoQ10 and lipoic acid. PMID: 26522469
  3. SAMC was expressed in mitochondria of all human tissues examined. The role of SAMC is likely to exchange cytosolic SAM for mitochondrial S-adenosylhomocysteine. This is the first reported identification and characterization of the human SAMC and its gene. PMID: 14674884
Database Links

HGNC: 20661

OMIM: 611037

KEGG: hsa:115286

STRING: 9606.ENSP00000336801

UniGene: Hs.379386

Involvement In Disease
Combined oxidative phosphorylation deficiency 28 (COXPD28)
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Highly expressed in testis, with moderate expression in brain, heart, kidney, lung, skeletal muscle, pancreas, small intestine and liver, and low expression in spleen.

Q&A

What is SLC25A26 and what is its subcellular localization?

SLC25A26 is a nuclear gene located on chromosome 3p14.1 that encodes the mitochondrial S-adenosylmethionine carrier (mSAMC), a member of the mitochondrial carrier family (MCF). The protein is primarily localized to the inner mitochondrial membrane in human cells, where it functions as a transporter . Unlike its plant orthologs which may have dual localization, human SLC25A26 appears to be exclusively mitochondrial. The protein exhibits the characteristic structural features of the mitochondrial carrier family, including transmembrane domains that form a channel through which its substrates are transported .

What is the primary function of SLC25A26 protein?

The primary function of SLC25A26 is to catalyze the transport of S-adenosylmethionine (SAM) from the cytosol into the mitochondria and the export of S-adenosylhomocysteine (SAH) from the mitochondria to the cytosol . Unlike its yeast ortholog, the human mSAMC primarily catalyzes countertransport rather than unidirectional transport, exhibiting a higher transport affinity for SAM . This transport activity is essential for providing the methyl donor SAM to the mitochondrial matrix, where it participates in methylation reactions of mitochondrial DNA, RNA, proteins, and specific amino acids .

How does SLC25A26 differ from its orthologs in other species?

SLC25A26 orthologs have been identified across different species with notable differences:

SpeciesProtein NameEncoding GeneLocalizationTransport Characteristics
HumanSAMCSLC25A26Mitochondrial inner membranePrimarily countertransport, high affinity for SAM, strongly inhibited by tannic acid and Bromocresol Purple
Yeast (S. cerevisiae)Sam5p/Pet8pPET8Mitochondrial inner membraneCatalyzes countertransport between SAM and mitochondrial SAH, SAC, or adenosylornithine
ArabidopsisSAMC1At4g39460Mitochondria and chloroplast envelopeCatalyzes countertransport between SAM and SAH or SAC
ArabidopsisSAMC2At1g34065MitochondriaCatalyzes countertransport between SAM and SAH or SAC

The human SLC25A26 shows higher transport specificity compared to yeast ortholog and exhibits distinct inhibition patterns .

What are the recommended approaches for recombinant expression of human SLC25A26?

For recombinant expression of human SLC25A26, bacterial expression systems have been successfully employed. Based on the available research, the methodology involves:

  • Cloning the complete human SLC25A26 cDNA sequence into a bacterial expression vector

  • Transforming the construct into a compatible bacterial strain (typically E. coli)

  • Inducing protein expression under optimized conditions

  • Purifying the recombinant protein, often using affinity chromatography

  • Reconstituting the purified protein into phospholipid vesicles for functional studies

This approach allows for the production of functional protein that can be used in transport assays. When expressing SLC25A26, researchers should be mindful of potential toxicity issues due to the protein's carrier function, which might necessitate the use of tightly regulated inducible expression systems .

How can researchers measure SLC25A26 transport activity?

To assess SLC25A26 transport activity, researchers typically employ reconstituted liposome-based transport assays:

  • Purify recombinant SLC25A26 protein

  • Reconstitute the protein into phospholipid vesicles (liposomes)

  • Pre-load the liposomes with specific substrates (e.g., SAH)

  • Initiate transport by adding external substrate (e.g., radiolabeled SAM)

  • Measure substrate uptake over time using filtration and scintillation counting

  • Calculate transport kinetics (Km, Vmax) based on concentration-dependent uptake

Key parameters to monitor include substrate specificity, transport affinity, and inhibition profiles. The human SLC25A26 has been shown to have a higher transport affinity for SAM compared to its yeast ortholog and is strongly inhibited by tannic acid and Bromocresol Purple, which can serve as useful experimental controls .

How does SLC25A26 contribute to mitochondrial function?

SLC25A26 plays a critical role in mitochondrial function through several mechanisms:

  • Methylation support: By importing SAM into mitochondria, SLC25A26 provides the methyl donor required for methylation of mitochondrial DNA, RNA, proteins, and amino acids .

  • Respiratory chain regulation: SLC25A26 expression levels influence the methylation status of mitochondrial DNA, which in turn affects the expression of key respiratory complex subunits and ATP generation .

  • Cofactor biosynthesis: SLC25A26-mediated SAM transport supports the biosynthesis of essential cofactors like lipoic acid (LA) and coenzyme Q10 (CoQ10), which are crucial for mitochondrial respiratory function .

Mutations in SLC25A26 can lead to severe mitochondrial dysfunction, as observed in patients with combined oxidative phosphorylation deficiency 28 (COXPD28), characterized by impaired mitochondrial translation and respiratory chain deficiencies .

What is the role of SLC25A26 in cancer biology?

SLC25A26 has emerged as an important factor in cancer biology with context-dependent functions:

  • Expression patterns: SLC25A26 is abnormally expressed in several cancers, including cervical cancer, low-grade glioma, and non-small cell lung cancer .

  • Epigenetic regulation: In cervical cancer cells (CaSki), SLC25A26 gene promoter hypermethylation leads to its downregulation, resulting in decreased mitochondrial SAM levels and increased cytoplasmic SAM .

  • Metabolic reprogramming: Downregulation of SLC25A26 in cancer cells can enhance the methionine cycle in the cytoplasm, reducing homocysteine and reactive oxygen species (ROS) while increasing glutathione (GSH), which collectively promotes cancer cell survival and proliferation .

  • Therapeutic implications: Overexpression of SLC25A26 increases mitochondrial SAM levels, enhances mitochondrial DNA methylation, inhibits respiratory complex function, and promotes cytochrome c release, potentially sensitizing cancer cells to chemotherapy agents like cisplatin .

Notably, both extremely high and extremely low SLC25A26 expression can lead to cancer cell inhibition or death via distinct pathways, suggesting dual therapeutic approaches might be feasible .

What is known about SLC25A26's role in cardiac function?

Recent research has revealed that SLC25A26 plays a crucial role in cardiac function:

  • Cardiomyocyte expression: Cardiomyocytes are among the top cell types expressing SLC25A26, which maintains low-level cytoplasmic SAM in the heart .

  • Response to cardiac stress: During cardiac hypertrophy, SAM biosynthesis is activated and drives mitochondrial translocation of SLC25A26 to shuttle excessive SAM into mitochondria .

  • Genetic models: Systemic deletion of Slc25a26 causes embryonic lethality, while cardiac-specific deletion leads to spontaneous heart failure and exacerbates cardiac hypertrophy induced by transaortic constriction .

  • Therapeutic potential: SLC25A26 overexpression, both before or after transaortic constriction surgery, rescues hypertrophic pathologies and protects against heart failure .

  • Proteome regulation: Slc25a26 knockdown suppresses proteins related to ribosomes and cardiac muscle contraction while upregulating proteasome-related proteins, suggesting a compensatory response to reduce ribosome biogenesis and augment protein degradation .

These findings indicate SLC25A26-mediated SAM compartmentalization coordinates translation and bioenergetics during cardiac hypertrophy, representing a potential therapeutic target for heart disease .

What molecular mechanisms link SLC25A26 to methylation-dependent cellular processes?

SLC25A26 regulates methylation-dependent cellular processes through its central role in SAM trafficking:

  • Mitochondrial DNA methylation: By controlling SAM availability in mitochondria, SLC25A26 directly impacts mitochondrial DNA methylation status, which regulates expression of key respiratory complex subunits .

  • RNA methylation pathway: SLC25A26 deficiency impairs mitochondrial RNA methylation, affecting rRNA stability and tRNA maturation, which in turn impacts ribosomal assembly and de novo translation processes in mitochondria .

  • Protein methylation: SLC25A26-mediated SAM transport supports methylation of specific mitochondrial proteins, including ADP/ATP translocase genes (ANT1 and ANT2) and electron transfer flavoprotein (ETFβ) .

  • Intersection with other metabolic pathways: The methylation reactions facilitated by SLC25A26-transported SAM connect with the transsulfuration pathway, the folate cycle, the methionine salvage pathway, and polyamine synthesis, all maintaining important cellular functions .

The interconnected nature of these pathways means that alterations in SLC25A26 expression or function can have widespread effects on cellular metabolism and gene expression .

What experimental challenges exist in studying SLC25A26-dependent methylation processes?

Researchers face several challenges when investigating SLC25A26-dependent methylation processes:

  • Compartment-specific measurement: Accurately measuring SAM and SAH levels specifically within mitochondria versus cytosol requires careful subcellular fractionation and analytical techniques.

  • Distinguishing direct from indirect effects: Since SAM is involved in numerous methylation reactions, determining which phenotypic changes result directly from altered SLC25A26 function versus secondary metabolic adaptations can be challenging.

  • Temporal dynamics: The kinetics of SAM transport and utilization may vary across different cellular states and stress conditions, requiring time-course experiments.

  • Tissue-specific regulation: SLC25A26 expression and activity appear to be regulated in a tissue-specific manner, necessitating context-appropriate experimental models .

  • Functional redundancy: Potential compensatory mechanisms may exist for SAM transport and methylation reactions when SLC25A26 function is compromised, complicating interpretation of knockout studies.

To address these challenges, researchers should employ complementary approaches including genetic models, pharmacological interventions, and combined metabolomics and methylome analyses.

How can genetic models be used effectively to study SLC25A26 function?

Genetic models provide powerful tools for investigating SLC25A26 function:

  • Conditional knockout approaches: Since systemic deletion of Slc25a26 causes embryonic lethality, tissue-specific conditional knockout models (using Cre-loxP systems) allow investigation of SLC25A26 function in specific contexts, as demonstrated in cardiac-specific deletion studies .

  • Knockdown systems: RNA interference or CRISPR interference approaches can be used to achieve partial reduction of SLC25A26 expression, allowing study of dose-dependent effects while avoiding complete loss of function.

  • Overexpression models: Transgenic overexpression of SLC25A26 can reveal gain-of-function phenotypes and potential therapeutic applications, as shown in cardiac hypertrophy rescue experiments .

  • Point mutation models: Introduction of specific mutations observed in human mitochondrial diseases can help elucidate structure-function relationships and disease mechanisms.

  • Cell-type specific analyses: Single-cell approaches combined with genetic models can reveal cell-type specific requirements for SLC25A26 function within complex tissues.

When developing these models, researchers should consider potential compensatory mechanisms, developmental effects, and the appropriate timing of genetic manipulation relative to disease progression or cellular stress .

What is known about SLC25A26 mutations in human disease?

SLC25A26 mutations have been linked to serious human diseases:

  • Combined oxidative phosphorylation deficiency 28 (COXPD28): This is an intractable mitochondrial disease caused by SLC25A26 mutations that severely impair the function of SAMC in transporting SAM into mitochondria .

  • Disease manifestations: The phenotype can be severe and early-onset, characterized by a deficiency of mitochondrial SAM input, leading to lack of methylation substrates and impaired mitochondrial biosynthesis .

  • Molecular consequences: SLC25A26 mutations affect:

    • mtRNA methylation, impairing rRNA stability and tRNA maturation

    • Ribosomal assembly and de novo translation in mitochondria

    • Reduced levels of respiratory complex subunits like COXII

    • Hypomethylation of ADP/ATP translocase genes and electron transfer proteins

    • Impaired biosynthesis of lipoic acid and coenzyme Q10

    • Decreased mitochondrial ATP production

What potential therapeutic strategies targeting SLC25A26 are being explored?

Several therapeutic strategies targeting SLC25A26 are emerging:

  • Cancer therapy approaches:

    • Inhibitors of SLC25A26 (SAMC) have been discovered, though their effects on cancer remain to be studied

    • The copper complex CTB has shown to inhibit tumorigenesis in vivo by upregulating SLC25A26 expression

    • Both extremely high and low levels of SLC25A26 expression could lead to cancer cell inhibition or death via distinct pathways, suggesting dual therapeutic approaches

  • Cardiac disease interventions:

    • SLC25A26 overexpression has shown promise in rescuing hypertrophic pathologies and protecting against heart failure in experimental models

    • Targeting the SAM compartmentalization process could represent a novel therapeutic approach for cardiac hypertrophy

  • Mitochondrial disease considerations:

    • For COXPD28 caused by SLC25A26 mutations, potential therapeutic strategies might include:

      • Direct delivery of SAM to mitochondria using alternative carriers

      • Boosting residual SLC25A26 activity in patients with hypomorphic mutations

      • Targeting downstream pathways affected by SAM deficiency

These approaches remain largely experimental, and further research is needed to develop clinically viable therapies targeting SLC25A26 and related pathways.

What are the key unanswered questions about SLC25A26 biology?

Despite recent advances, several important questions about SLC25A26 remain unanswered:

  • Structural insights: The detailed molecular structure of SLC25A26 and how it facilitates selective transport of SAM and SAH across the mitochondrial membrane remains to be fully elucidated.

  • Regulatory mechanisms: How SLC25A26 expression and activity are regulated under different physiological and pathological conditions, including the observed mitochondrial translocation during cardiac hypertrophy .

  • Cancer context specificity: Why SLC25A26 exhibits different expression patterns across cancer types and how these differences relate to cancer cell metabolism and therapeutic susceptibility .

  • Immune modulation: The impact of SLC25A26 expression on immune cell infiltration in tumor microenvironments and its subsequent influence on cancer progression through immune modulation .

  • Post-translational modifications: The role of potential post-translational modifications in regulating SLC25A26 function and cellular localization.

  • Therapeutic potential: The exploration of SLC25A26 inhibitors or activators as novel cancer gene therapies and their mechanisms of action .

Addressing these questions will require integrated approaches combining structural biology, systems biology, and translational research.

What methodological advances would enhance SLC25A26 research?

Several methodological advances could significantly enhance SLC25A26 research:

  • Real-time monitoring: Development of fluorescent sensors or biosensors to monitor SAM transport activity in live cells and organelles in real-time.

  • Structural analysis: Advanced cryo-EM or crystallography approaches to resolve the structure of SLC25A26, particularly in complex with its substrates.

  • Single-cell metabolomics: Techniques to measure SAM and methylation patterns at the single-cell level would reveal heterogeneity in SLC25A26 function within tissues.

  • Targeted delivery systems: Methods to specifically deliver SAM to mitochondria independently of SLC25A26, which could be valuable for both research and therapeutic applications.

  • High-throughput screening platforms: Development of cellular assays suitable for screening SLC25A26 modulators (activators and inhibitors) in a high-throughput format.

  • Integrative omics approaches: Combining transcriptomics, proteomics, metabolomics, and methylome analyses to comprehensively assess the impact of SLC25A26 modulation on cellular physiology.

These methodological advances would facilitate more precise analysis of SLC25A26 function and accelerate translational applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.