Recombinant Human Sarcospan (SSPN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Specify your desired tag type for prioritized development.
Synonyms
SSPN; KRAG; Sarcospan; K-ras oncogene-associated protein; Kirsten-ras-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SSPN
Target Protein Sequence
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ LALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFS MKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRD VTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQ QKI
Uniprot No.

Target Background

Function
Sarcospan is a component of the dystrophin-glycoprotein complex (DGC), a transmembrane complex in muscle cells. The DGC links the F-actin cytoskeleton to the extracellular matrix. Sarcospan preferentially interacts with the sarcoglycan subcomplex within the DGC.
Gene References Into Functions
  1. Our research indicates that TWIST1 and SSPN are functionally relevant genes for androgenetic alopecia at the 7p21.1 and 12p12.1 loci, respectively. PMID: 27060448
  2. In mdx mice, a three-fold increase in human SSPN expression enhanced adhesion complex abundance, improving muscle membrane stability and mitigating histopathological changes associated with Duchenne muscular dystrophy. PMID: 27798107
  3. Sarcospan's role as a candidate gene in congenital fibrosis of the extraocular muscles type 1 has been analyzed. PMID: 11180757
  4. A study examined the frequent polymorphism of the peroxisome proliferator-activated receptor gamma gene in colorectal cancer with wild-type K-ras. PMID: 11956653
  5. Sarcospan plays a significant mechanical role in stabilizing the dystrophin-glycoprotein complex. PMID: 17311848
  6. The crystal structure of Importin β (127-876) in complex with SPN1 (1-65) at 2.8-Å resolution reveals that Importin β adopts an open conformation, unique for a functional Importin β/cargo complex, similar to the Importin β/RanGTP complex conformation. PMID: 18028944
  7. Decreased sarcospan expression has been observed on the myofiber surfaces in Fukuyama congenital muscular dystrophy. PMID: 18830929
  8. In transgenic mice, human SSPN directly interacts with the utrophin-glycoprotein complex, stabilizing utrophin protein without affecting its transcription. PMID: 18981229
Database Links

HGNC: 11322

OMIM: 601599

KEGG: hsa:8082

STRING: 9606.ENSP00000242729

UniGene: Hs.183428

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is expressed exclusively in heart and skeletal muscle. Isoform 2 is expressed in heart, skeletal muscle, thymus, prostate, testis, ovary, small intestine, colon and spleen.

Q&A

What is Sarcospan (SSPN) and what is its molecular structure?

Sarcospan (SSPN) is a 25-kD dystrophin-associated protein that functions as an integral member of the dystrophin-glycoprotein complex (DGC), essential for maintaining sarcolemmal integrity in muscle cells . Structurally, SSPN is characterized by four transmembrane domains with a large extracellular loop, making it unique among dystrophin-associated proteins . Hydropathy analysis predicts these multiple sarcolemma-spanning helices, which give the protein its name . Dendrogram analysis categorizes SSPN as a member of the transmembrane four or tetraspan superfamily of proteins, which are known to play important roles in mediating transmembrane protein interactions . The protein's structure positions it strategically to facilitate interactions between subcomplexes of the DGC, making it functionally significant beyond mere structural support .

How does SSPN integrate into muscle membrane architecture?

SSPN is expressed throughout the sarcolemma of normal human skeletal muscle and is additionally enriched at specialized structures including the myotendinous junction (MTJ) and neuromuscular junction (NMJ) . Within the sarcolemmal architecture, SSPN preferentially associates with the sarcoglycan (SG) subcomplex, forming what is commonly referred to as the SG-SPN subcomplex . This interaction is critical for the stable localization of SSPN to the sarcolemma, NMJ, and MTJ, as evidenced by experimental data showing that assembly of the SG subcomplex is a prerequisite for targeting SSPN to the sarcolemma . The SG-SPN subcomplex functions to stabilize α-dystroglycan to the muscle plasma membrane, strengthening the interaction between β-dystroglycan, α-dystroglycan, and dystrophin . SSPN contributes to membrane stability by improving cell surface expression of three major laminin-binding complexes: the dystrophin-glycoprotein complex (DGC), the utrophin-glycoprotein complex, and α7β1-integrin .

What is the significance of SSPN in muscular dystrophy research?

Sarcospan has emerged as a significant research focus in muscular dystrophy due to its demonstrated ability to ameliorate disease pathology when overexpressed in dystrophin-deficient models . The protein's importance stems from its ability to enhance the stability of compensatory protein complexes that can functionally substitute for the absent dystrophin-glycoprotein complex in Duchenne muscular dystrophy (DMD) . Research has shown that transgenic expression of SSPN causes increased levels of dystrophin at the sarcolemma in normal skeletal muscle and increases levels of utrophin-glycoprotein and α7β1D integrin at the sarcolemma, which restored laminin-binding and reduced skeletal muscle necrosis . Beyond skeletal muscle, SSPN has demonstrated important functions in cardiac muscle, where its overexpression in DMD (mdx TG) mice improved adhesion, sarcolemmal structure, and cardiac function, supporting a critical role for SSPN in protecting against both transient and chronic myocardial injury . These findings position SSPN as both a research tool for understanding dystrophic mechanisms and a potential therapeutic target .

How does modulation of SSPN expression affect cellular signaling pathways in dystrophic muscle?

SSPN modulation significantly impacts multiple signaling pathways due to its strategic position within the dystrophin-glycoprotein complex (DGC), which functions not only as a structural support but also as a cellular signaling complex . When SSPN is overexpressed in dystrophic models, it enhances the membrane localization of utrophin-glycoprotein and α7β1-integrin complexes, which are known to influence downstream signaling cascades including the extracellular signal-regulated kinase (ERK)-mitogen activated protein kinase (MAPK) pathway . Research indicates that β-dystroglycan, a protein whose interaction with the sarcolemma is strengthened by the sarcoglycan-SSPN complex, interacts with MEK and ERK, suggesting that SSPN indirectly influences the ERK-MAPK cascade through such scaffolding interactions . In SSPN-null mice, researchers observed increased cardiac hypertrophy in response to β-adrenergic challenge, indicating that SSPN loss affects hypertrophic signaling pathways through complex mechanisms that may involve multiple signaling cascades . The protective effects of SSPN overexpression in dystrophic models appear to be mediated through enhanced cell-extracellular matrix adhesion and improved cytoskeletal-based signaling, which are crucial for cell survival particularly in the context of mechanical stress .

What molecular mechanisms explain SSPN's ability to strengthen sarcolemmal integrity?

The molecular mechanisms underlying SSPN's protective effect on sarcolemmal integrity involve multiple pathways centered on enhancing membrane-associated protein complexes that link the extracellular matrix to the cytoskeleton . SSPN improves sarcolemmal integrity primarily by increasing the abundance and stability of key laminin-binding protein complexes at the cell surface, including the dystrophin-glycoprotein complex, utrophin-glycoprotein complex, and α7β1-integrin . When dystrophin is absent, as in Duchenne muscular dystrophy, the sarcolemma becomes highly susceptible to contraction-induced damage, as demonstrated in studies showing that mdx myotubes are more vulnerable to hypo-osmotic shock than control cells . SSPN overexpression compensates for this vulnerability by upregulating utrophin, which is structurally and functionally similar to dystrophin, and by enhancing integrin-based adhesion systems that provide alternative mechanical linkages between the extracellular matrix and the cytoskeleton . At the molecular level, SSPN appears to function as an organizing center that facilitates the proper assembly and sarcolemmal targeting of these compensatory protein complexes, thereby maintaining the crucial physical coupling between the sarcolemmal membrane and the Z disk region that stabilizes the membrane against mechanical forces produced during muscle contraction .

How does the interaction between SSPN and sarcoglycan complex influence membrane protein trafficking?

The interaction between SSPN and the sarcoglycan complex plays a critical role in membrane protein trafficking and stability, particularly in the context of muscular dystrophies . Experimental evidence demonstrates that SSPN preferentially associates with the sarcoglycan subcomplex (composed of α, β, γ, and δ isoforms), and this interaction is essential for the stable localization of SSPN to the sarcolemma, neuromuscular junction, and myotendinous junction . Assembly of the sarcoglycan subcomplex appears to be a prerequisite for targeting SSPN to the sarcolemma, suggesting a hierarchical organization in the trafficking pathway of these membrane proteins . The SG-SSPN subcomplex, once assembled, functions to stabilize α-dystroglycan at the muscle plasma membrane, which in turn strengthens the critical interaction between β-dystroglycan, α-dystroglycan, and dystrophin . In the absence of sarcoglycans, as seen in certain forms of limb-girdle muscular dystrophy, SSPN localization to the membrane is compromised, indicating that the trafficking mechanisms for these proteins are interdependent . This relationship explains why mutations in any of the four sarcoglycan transmembrane proteins result in autosomal recessive limb-girdle muscular dystrophy and why strategies aimed at enhancing SSPN expression may need to consider the status of the sarcoglycan complex to be effective .

What high-throughput screening approaches can identify modulators of SSPN expression?

High-throughput screening for SSPN modulators employs a systematic approach utilizing cell-based promoter reporter assays with established readout systems . The methodology begins with development of specialized reporter cell lines, such as the human sarcospan EGFP reporter C2C12 cell line (hSSPN-EGFP) and human sarcospan luciferase (hSSPN-luc) C2C12 cell line for primary and secondary screening respectively . For implementation, myoblasts are seeded at precise densities (500 cells per well in 384-well plates) and cultured to confluence before switching to differentiation medium containing 2% horse serum . Compound libraries (exceeding 200,000 curated small molecules) are administered on day 2 of differentiation using automated liquid handling systems such as the Biomek Fx (Beckman) . For the EGFP reporter assay, fluorescence is quantified after 48 hours of treatment using an Envision plate reader, while the luciferase assay involves aspirating media, adding Bright-Glo luciferase assay system reagent in a 1:2 dilution with differentiation medium, and measuring luminescence after a brief incubation . Data analysis focuses on calculating fold change of treated over vehicle-treated cells to identify compounds that significantly upregulate SSPN expression .

What cellular models are appropriate for validating SSPN modulators in dystrophic contexts?

Validation of SSPN modulators requires carefully selected cellular models that accurately represent dystrophic phenotypes while being amenable to experimental manipulation . The primary models employed include dystrophin-deficient mouse myotubes, such as the H2K myoblast cell line derived from the mdx mouse model of Duchenne muscular dystrophy . These cells are cultured under specific conditions: proliferation on 0.01% gelatin-coated plates at 33°C with growth medium containing DMEM, 20% HI-FBS, 2% L-glutamine, 2% chicken embryo extract, antibiotics, and interferon gamma (20 U/ml) . For differentiation, H2K myoblasts are seeded on matrigel-coated plates (0.1 mg/ml) and, upon reaching confluency, transitioned to 37°C with differentiation medium containing 5% horse serum . Human cellular models, such as immortalized human DMD myoblast cell lines, provide crucial translation validation and are cultured in Skeletal Muscle Basal Medium with 20% FBS and Skeletal Muscle Growth Supplement Mix, transitioning to differentiation medium containing Skeletal Muscle Differentiation Supplement Mix upon reaching confluency . Validation assays in these cellular models should include assessments of SSPN gene expression using quantitative PCR, protein expression via immunoblotting and ELISA, and functional effects through membrane stability assays such as osmotic shock followed by cell surface biotinylation .

What quantitative assays accurately measure SSPN protein levels in experimental samples?

Accurate quantification of SSPN protein levels employs multiple complementary approaches to ensure reliability and sensitivity across different experimental contexts . Immunoblotting represents a primary method, wherein protein samples are resolved by SDS-PAGE and transferred to membranes, which are then blocked in milk solution and probed with SSPN-specific antibodies (commonly sc-393187 from Santa Cruz Biotechnology) . Detection utilizes secondary antibodies conjugated to HRP with visualization via chemiluminescence, and densitometric analysis with software such as ImageJ allows quantification relative to loading controls like GAPDH . For higher throughput and sensitivity, an SSPN-specific ELISA protocol provides quantitative data: 96-well plates are coated with SSPN antibody (1 μg/ml), blocked with 1% BSA, and incubated with recombinant human SSPN standards alongside experimental samples . Detection employs a second SSPN antibody (LS-C747357 at 400 ng/ml) followed by HRP-conjugated secondary antibody, with signal development using appropriate substrates . For in vivo samples, SSPN levels can be assessed in muscle tissue from animal models (such as mdx mice) following treatment with candidate compounds, using both gene expression analysis via quantitative PCR and protein quantification via the methods described above .

How should researchers interpret changes in SSPN expression in relation to compensatory protein complexes?

Interpretation of SSPN expression changes requires careful consideration of its relationships with compensatory protein complexes that functionally substitute for dystrophin in dystrophic conditions . When analyzing data, researchers should examine SSPN modulation in the context of coordinated changes in utrophin-glycoprotein complex and α7β1-integrin expression, as these three complexes represent the major laminin-binding systems at the sarcolemma . Data showing increased SSPN expression without corresponding increases in these compensatory complexes may indicate insufficient therapeutic potential, while coordinated upregulation suggests effective compensation for dystrophin deficiency . Researchers should interpret SSPN-related data within the framework of the "mechanical hypothesis" of muscular dystrophy, which posits that membrane fragility leads to progressive cellular necrosis characteristic of the disease . Quantitative analyses should include measurements of membrane stability (e.g., resistance to hypo-osmotic shock), as improved stability despite dystrophin absence provides functional validation of SSPN's compensatory effects . When analyzing cardiac versus skeletal muscle data, researchers should recognize tissue-specific differences in protein complex expression and function, as demonstrated by studies showing that SSPN-null mice exhibited cardiac-specific consequences including cardiac enlargement, myocyte hypertrophy, and increased interstitial fibrosis in response to β-adrenergic challenge .

What considerations are important when analyzing SSPN modulator screening data?

Analysis of high-throughput screening data for SSPN modulators requires rigorous statistical and biological validation approaches to distinguish genuine hits from false positives . Primary considerations include establishing appropriate statistical thresholds for hit identification, typically focusing on compounds that increase SSPN expression by at least 2-3 standard deviations above vehicle controls . Researchers must implement multi-stage validation processes, beginning with confirmation in both reporter systems (EGFP and luciferase) to eliminate reporter-specific artifacts . Dose-response relationships must be established across concentration ranges to determine EC50 values and maximum efficacy, while cytotoxicity assessments ensure that apparent increases in reporter signal are not artifacts of cellular stress responses . Mechanistic validation requires demonstrating that reporter activation translates to increased endogenous SSPN gene expression (via qPCR) and protein levels (via immunoblotting/ELISA) in dystrophin-deficient mouse and human myotubes . Functional validation through membrane stability assays provides critical evidence that SSPN upregulation confers meaningful cellular protection . Finally, researchers should consider structural clustering of hit compounds to identify common pharmacophores, enabling structure-activity relationship studies that can guide medicinal chemistry optimization of lead compounds for increased potency, selectivity, and pharmacokinetic properties .

What emerging therapeutic strategies leverage SSPN for muscular dystrophy treatment?

Emerging therapeutic strategies targeting SSPN represent promising approaches for muscular dystrophy treatment through multiple distinct mechanisms . Pharmacological upregulation of SSPN using small molecule compounds identified through high-throughput screening offers a non-genetic approach that could be developed into oral therapeutics with potentially broad applicability across different forms of muscular dystrophy . These compounds would ideally increase endogenous SSPN gene and protein expression in dystrophin-deficient muscle, thereby enhancing membrane stability via the compensatory mechanisms described previously . Gene therapy approaches represent another frontier, where viral vectors delivering SSPN transgenes could achieve local or systemic overexpression, as demonstrated successfully in preclinical models where transgenic overexpression of human SSPN in mdx mice improved adhesion, sarcolemmal structure, and cardiac function . Combinatorial approaches that simultaneously target SSPN and other components of the membrane stabilization system (such as utrophin or integrins) may provide synergistic benefits by enhancing multiple compensatory pathways simultaneously . Cell-based therapies incorporating ex vivo genetic modification to overexpress SSPN in patient-derived or allogeneic myogenic progenitor cells could provide another therapeutic avenue, particularly if combined with approaches to enhance cellular engraftment and differentiation . Future research should focus on optimizing these approaches and determining which patient populations might benefit most from SSPN-targeted therapies .

How might systems biology approaches advance our understanding of SSPN's role in muscle membrane biology?

Systems biology approaches offer powerful frameworks for investigating SSPN's complex role within the intricate network of muscle membrane proteins and signaling pathways . Multi-omics integration combining transcriptomics, proteomics, and interactomics data could reveal the broader impact of SSPN modulation on global gene expression patterns, protein abundances, and interaction networks in normal and dystrophic muscle contexts . Network analysis algorithms applied to these datasets could identify previously unrecognized functional connections between SSPN and other cellular components, potentially revealing novel therapeutic targets or synergistic intervention points . Computational modeling of membrane protein trafficking and assembly pathways could elucidate the hierarchical relationships governing SSPN localization and function, providing insights into how to most effectively target the system for therapeutic benefit . Single-cell approaches examining heterogeneity in SSPN expression and function across different muscle fiber types, developmental stages, and disease states would address currently overlooked complexities in SSPN biology . Systems pharmacology modeling integrating pharmacokinetic/pharmacodynamic properties of SSPN modulators with their effects on multiple downstream pathways could optimize dosing regimens and identify potential off-target effects or drug interactions . These advanced approaches would move beyond reductionist views of SSPN as a single protein and instead conceptualize it as a node in a complex adaptive system, potentially revealing emergent properties that could not be predicted from isolated studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.