Recombinant Human SARS coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human SARS Coronavirus Membrane Protein (M)

The Recombinant Human SARS Coronavirus Membrane protein (M) is a vital component of the viral envelope, playing a key role in virus morphogenesis and assembly through its interactions with other viral proteins . The M protein is the most abundant structural protein in coronaviruses . It maintains the virion's size and shape . The SARS-CoV-2 M protein shares 90.5% sequence identity with the SARS-CoV M protein .

Structure and Composition

The SARS-CoV-2 M protein consists of 222 amino acids, including a short N-terminus (residues 1–19), a triple-transmembrane domain (TM, residues 20–100), and a longer C-terminal cytoplasmic domain (residues 101–222) . The M protein has a triple helix bundle and forms a single 3-transmembrane domain . It is homologous to the prokaryotic sugar transport protein . The predicted structure of the M protein is similar to the prokaryotic SemiSWEET sugar transport protein, with both containing three transmembrane helix bundles .

Functional Roles

  • Virus Assembly: The M protein is essential for coronavirus envelope assembly . It forms a mushroom-shaped dimer, composed of two transmembrane domain-swapped three-helix bundles and two intravirion domains . Both forms of the M protein might be important for inducing membrane curvature and controlling virus morphology .

  • Interaction with Other Viral Proteins: M protein can bind to all other structural proteins . Interactions between M and S proteins are essential for S protein retention in the Endoplasmic Reticulum–Golgi Intermediate Compartment (ERGIC) and its integration into new virions . The M protein interacts with the N protein .

  • Immune Response Modulation: M protein interferes with the host immune response through interferon antagonism . It has a protective antigen function .

  • Membrane Integration: SARS-CoV M protein goes to the endoplasmic reticulum membrane, though lacking a conventional signal peptide and predominately localizes in the Golgi complex .

Research Findings

Several research findings highlight the significance of the M protein:

  • Dominant Immunogen: The M protein of SARS-CoV holds dominant cellular immunogenicity .

  • Drug Target: The M protein is a promising target for the treatment of COVID-19 .

  • Conformational Changes: The M protein contains a highly conserved hinge region, whose mutations and deletions inhibit virus formation and mediates conformational changes between two forms .

  • Expression and Membrane Integration: When the SARS-CoV M gene was expressed in Vero E6 cells, in addition to the full-length un-glycosylated M protein, glycosylated M protein and one smaller product initiated in-fame from the third Met was also detected .

Data Tables

FeatureDescription
Amino Acid Count222
N-terminusResidues 1-19
Transmembrane Domain (TM)Residues 20-100 (triple-transmembrane)
C-terminal Cytoplasmic DomainResidues 101-222
Sequence Identity90.5% sequence identity with SARS-CoV M protein
FunctionMaintains virion size and shape, involved in virus assembly and release, interferes with host immune response .
StructureTriple helix bundle, forms a single 3-transmembrane domain .
DimerizationForms homodimers essential for coronavirus envelope assembly .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on shipping method and destination. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag is required, please inform us, and we will prioritize its use.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Target Names
M
Target Protein Sequence
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
Uniprot No.

Target Background

Function

A component of the viral envelope, the M protein plays a crucial role in viral morphogenesis and assembly through interactions with other viral proteins.

Gene References Into Functions
  1. Specific amino acids are critical for M protein function in directing virus assembly. PMID: 23700447
  2. Similar to the S protein, M acquires high-mannose N-glycans, which are subsequently modified into complex N-glycans in the Golgi apparatus. PMID: 15831954
  3. This study first reported the induction of apoptosis by the SARS-CoV M protein in animal cells, discussing potential implications. PMID: 16797548
  4. This research demonstrates that the M and N proteins of SARS-CoV can induce apoptosis in human pulmonary fibroblast cells. PMID: 16845612
  5. The crystal structure of M(pro) is reported at a resolution of 1.82 Å, in space group P2(1) at pH 6.0. PMID: 17196984
  6. The cytoplasmic C-terminus domain of the SARS-CoV M protein is responsible for binding to the nucleocapsid (N) protein. PMID: 18792806
  7. M protein expression prevents the formation of the TRAF3·TANK·TBK1/IKKε complex, thus inhibiting TBK1/IKKε-dependent activation of IRF3/IRF7 transcription factors. PMID: 19380580
Database Links

KEGG: vg:1489672

Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and basic characteristics of SARS-CoV-2 M protein?

The SARS-CoV-2 M protein is a 222-amino acid transmembrane protein that forms the most abundant component of the viral envelope. Structurally, it consists of:

  • Three transmembrane domains forming a triple-spanning transmembrane region

  • An N-terminal extracellular domain (ectodomain)

  • A C-terminal intracellular domain

  • Interconnecting loops (one extracellular and one intracellular)

The protein forms mushroom-shaped dimers composed of two transmembrane domain-swapped three-helix bundles and two intravirion domains . These dimers can further assemble into higher-order oligomers. The M protein contains a highly conserved hinge region that facilitates conformational changes between long and short forms, both of which appear necessary for viral assembly . Recent cryo-electron microscopy studies have revealed that the M protein structure is unexpectedly similar to the SARS-CoV-2 ORF3a viroporin .

  • What expression systems are available for producing recombinant SARS-CoV M protein?

Several expression systems have been successfully employed to produce recombinant SARS-CoV M protein:

Expression SystemTag OptionsAdvantagesConsiderations
E. coliGST, His-tagHigh yield, cost-effectiveMay lack proper post-translational modifications
HEK293 cellsFLAG, V5, HisProper folding, mammalian post-translational modificationsLower yield than bacterial systems
Baculovirus/insect cellsHis, StrepIIGood for membrane proteins, high yieldMore complex system to establish

For bacterial expression, studies have used vectors like pGEX-6P-1 for GST fusion proteins and pET-30a for His-tagged proteins . For mammalian expression, pcDNA3.1/V5-His A has been utilized with good results . When designing constructs, researchers often include a protease cleavage site (TEV, HRV-3C) between the tag and protein to facilitate tag removal .

  • How does glycosylation affect SARS-CoV M protein properties and function?

The M protein of SARS-CoV contains a single N-glycosylation site (Asn-Gly-Thr at positions 4-6) at its N-terminus, which is exposed on the exterior of the virion . Experimental evidence has confirmed:

  • Glycosylation occurs co-translationally in the presence of microsomes

  • Mutation of Asn4 to Asp prevents glycosylation

  • Glycosylation state does not appear to significantly affect viral growth

The glycosylation pattern varies among coronavirus groups - N-linked glycosylation is typically found in alpha and gamma coronaviruses, while O-linked glycosylation is common in beta coronaviruses, with SARS-CoV being an exception with its N-glycosylation .

Methodologically, glycosylation can be assessed by treatment with glycosidases such as N-glycosidase F or endoglycosidase H, followed by Western blot analysis to observe mobility shifts .

  • What purification strategies are effective for obtaining high-quality recombinant M protein?

Effective purification of recombinant M protein typically involves multiple steps:

Purification StepMethodologyConsiderations
Initial captureAffinity chromatography (Ni-NTA for His-tagged, GST resin for GST-fusion)Buffer should contain detergents (0.02% Triton X-100) for membrane proteins
Tag removalProtease treatment (TEV, HRV-3C)Optimize cleavage conditions
Further purificationSize exclusion chromatography (Superdex 200)Ensures high purity and proper oligomeric state
ConcentrationCentrifugal filters (appropriate MW cut-off)Avoid protein aggregation

Buffer optimization is critical - successful purification has been achieved using buffers containing 25 mM Tris-HCl or HEPES (pH 7.5-8.0), 500 mM NaCl, and 5% glycerol . For membrane protein studies, incorporation into lipid nanodiscs has proven effective for structural studies .

  • What methods can be used to assess the functionality of recombinant M protein?

Functional assessment of recombinant M protein can be performed using several complementary approaches:

  • Protein-protein interaction assays: Co-immunoprecipitation assays to detect interactions with other viral proteins, particularly nucleocapsid (N) protein

  • Oligomerization analysis: Size exclusion chromatography, blue native PAGE, or analytical ultracentrifugation to assess oligomeric state

  • Membrane association: Cellular fractionation followed by Western blotting to confirm proper membrane integration

  • Virus-like particle (VLP) formation: Co-expression with other viral structural proteins to assess M protein's ability to drive particle assembly

  • Glycosylation state: Western blot analysis with glycosidase treatment to confirm proper post-translational modifications

Experimental controls should include known non-functional M protein mutants, particularly those with alterations in the conserved hinge region or transmembrane domains.

Advanced Research Questions

  • How can conformational changes in M protein dimers be analyzed experimentally?

The M protein exists in two conformational states (long and short forms) that appear critical for virus assembly. Analyzing these conformational changes requires sophisticated biophysical approaches:

  • Cryo-electron microscopy (cryo-EM): The gold standard for visualizing different conformational states of M protein. This approach has successfully captured both long and short forms of the dimer structure

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Can map regions undergoing conformational changes by measuring solvent accessibility

  • Single-molecule FRET: By labeling specific residues with fluorophores, conformational changes can be monitored in real-time

  • Molecular dynamics simulations: Computational approaches can predict conformational transitions and stability of different states

  • Site-directed spin labeling combined with EPR spectroscopy: Provides information about distances between specific residues in different conformational states

When designing experiments to study conformational changes, focus on the highly conserved hinge region (which mediates transitions between forms) and consider the role of lipid-like densities that appear to stabilize the long form of the protein .

  • What mutagenesis strategies are most effective for studying M protein structure-function relationships?

Strategic mutagenesis has proven valuable for dissecting M protein domains and their functions. Based on published research, effective approaches include:

Mutagenesis StrategyTarget RegionsFunctional Assessment
Alanine scanningPositively charged residues (K166, K180, R198, R200)N protein interaction analysis
Alanine clustersHis/Arg residues (H125, R146, H148, H155, R158, K162, R186)Assess viral assembly
Deletion mutantsHinge region (aa 105-118), C-terminal domain (aa 119-222)Immunoprecipitation assays
Transmembrane domain swapsTM regions (aa 14-36, 46-68, 78-100)Membrane insertion efficiency
Glycosylation site mutationsN4D mutationGlycosylation analysis

When designing mutations, consider:

  • Using complementary approaches (point mutations, deletions, domain swaps)

  • Including conservative and non-conservative substitutions

  • Targeting evolutionarily conserved residues

  • Focusing on charged residues in the intravirion domain that may mediate interactions

Validate mutant effects using both biochemical assays (protein-protein interactions) and functional assays (VLP formation) .

  • How can the interaction between M protein and other viral components be characterized at the molecular level?

Characterizing molecular interactions between M protein and other viral components requires multiple complementary approaches:

  • Co-immunoprecipitation assays: Effective for detecting protein-protein interactions, particularly between M and N proteins. Studies have used HA-tagged M protein variants to successfully pull down interacting partners

  • Surface plasmon resonance (SPR): Provides quantitative binding kinetics and affinity measurements between purified components

  • Microscale thermophoresis (MST): Useful for measuring interactions in solution with minimal protein consumption

  • Yeast two-hybrid or mammalian two-hybrid assays: Can map interaction domains between M protein and other viral proteins

  • Cryo-electron tomography: Visualizes arrangement of M protein relative to other components in intact virions

  • Cross-linking mass spectrometry: Identifies specific residues involved in protein-protein contacts

For RNA-protein interactions:

  • Electrophoretic mobility shift assays (EMSA)

  • RNA immunoprecipitation

  • CLIP-seq approaches

Based on experimental evidence, focus on the positively charged intravirion domain of M protein, which appears critical for recruiting N protein and RNA during virion assembly .

  • What is known about the immunogenicity of M protein, and how can this be leveraged for vaccine development?

The M protein has demonstrated significant immunogenicity, particularly in its N-terminal ectodomain:

  • The majority of SARS-CoV-2-infected patients produce N-terminal ectodomain-specific IgG antibodies during convalescence

  • Inactivated vaccine recipients also show seroconversion against the N-terminal ectodomain

  • The M protein ectodomain contains multiple B-cell epitopes

  • M protein sequences are highly conserved among sarbecoviruses, suggesting potential for cross-protective immunity

Experimental approaches to assess M protein immunogenicity include:

ApproachMethodologyApplication
Epitope mappingSynthetic peptide arrays screened with patient seraIdentified immunogenic regions in SARS-CoV M protein
CTL response analysisHLA-restricted T cell assaysRevealed dysfunctional M-specific CTL responses in severe COVID-19
Cross-reactivity testingELISA with sarbecovirus M proteinsEvaluates potential breadth of protective responses
Vaccine candidate testingM ectodomain immunization in animal modelsRestrains viral replication in challenge studies

Researchers have identified four segments of M protein (amino acids 1-20, 137-157, 189-211, and 206-221) that consistently react with antibodies from SARS patients . The conserved nature of M protein makes it a promising target for broadly protective vaccine strategies against current and future sarbecoviruses .

  • What are the most effective methods for studying M protein's role in viral assembly and membrane curvature?

The M protein plays a crucial role in organizing viral assembly and influencing membrane curvature. Advanced methodologies to study these processes include:

  • Cryo-electron tomography: Provides 3D visualization of membrane curvature induced by M protein oligomers. Studies have observed tandemly arranged M protein oligomers inducing slight membrane curvature

  • Virus-like particle (VLP) formation assays: Co-expression of M with N protein (minimal components for VLP formation) allows assessment of assembly efficiency

  • Fluorescently tagged M protein visualization: Live-cell imaging to track M protein dynamics during assembly

  • Lipid nanodisc reconstitution: Incorporation of purified M protein into defined lipid environments for biophysical studies

  • Atomic force microscopy: Measures membrane deformation at the nanoscale level

  • Correlative light and electron microscopy (CLEM): Combines the specificity of fluorescence microscopy with the resolution of EM

Research has revealed that both conformations of M protein (long and short forms) are important for proper virion morphology, with the long form responsible for rigidity and narrow curvature, while the short form provides flexibility . When designing experiments, consider incorporating lipid composition variables, as the membrane environment appears important for proper M protein conformation and function .

  • How can recombinant M protein be incorporated into reporter virus systems for studying viral entry and assembly?

Recombinant reporter virus systems have been instrumental in studying SARS-CoV-2 biology. To incorporate M protein studies into these systems:

  • Fluorescent/luminescent reporter viruses: SARS-CoV-2 constructs expressing Venus, mCherry, or Nluc reporters have been successfully generated and maintain growth kinetics similar to wild-type virus . These systems allow high-throughput screening of M protein mutants.

  • Pseudotyped virus systems: HIV-luc pseudotyped with SARS-CoV-2 proteins can be used to study M protein's role in viral entry and assembly .

Reporter SystemApplicationsConsiderations
rSARS-CoV-2-Venus/mCherryReal-time visualization of infectionBSL-3 requirement, viral replication dynamics
rSARS-CoV-2-NlucHigh-throughput neutralization assaysSuperior sensitivity for quantitative studies
HIV/SARS pseudovirusEntry studies, no viral replicationMay not fully recapitulate all M protein functions

Methodological approaches:

  • Generate M protein mutations in reporter virus backbone

  • Verify reporter expression correlates with viral replication

  • Compare growth kinetics and plaque phenotypes to wild-type

  • Use reporter signal as readout for high-throughput screening

These systems are particularly valuable for identifying drugs or neutralizing antibodies that target M protein or M protein-dependent processes .

  • What biophysical techniques provide the most insight into M protein structure and dynamics?

Understanding M protein structure and dynamics requires multiple complementary biophysical approaches:

  • Cryo-electron microscopy (cryo-EM): Has provided the highest-resolution structures of M protein, revealing its mushroom-shaped dimeric architecture and conformational states

  • Circular dichroism (CD) spectroscopy: Effective for assessing secondary structure composition. Analysis of recombinant M protein has revealed approximately 46% alpha-helix structure (likely from the ACE2 region) and about 22% beta sheets (likely from the Fc adduct), with the remaining 32% as random coils

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility

  • Nuclear magnetic resonance (NMR) spectroscopy: Particularly useful for studying flexible regions and dynamic processes

  • Molecular dynamics simulations: Computational approaches that can predict transmembrane domain interactions and conformational changes

  • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

When designing biophysical studies, consider:

  • Membrane mimetics (nanodiscs, liposomes) to maintain native-like environment

  • The impact of detergents on protein structure and function

  • Complementary techniques to validate structural findings

  • The influence of glycosylation on structural properties

The combination of these approaches has revealed that M protein structure is similar to SARS-CoV-2 ORF3a viroporin, though unlike ORF3a, M functions primarily as a structural scaffold protein rather than an ion channel .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.