Recombinant Severe acute respiratory syndrome coronavirus ORF3a protein (3a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
3a; ORF3a protein; Accessory protein 3a; Protein 3a; Protein U274; Protein X1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Target Names
3a
Target Protein Sequence
MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSAT KIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINA CRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKL KEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
Uniprot No.

Target Background

Function
This protein forms homotetrameric potassium-sensitive ion channels (viroporins) and may modulate virus release. It upregulates the expression of fibrinogen subunits FGA, FGB, and FGG in host lung epithelial cells, induces apoptosis in cell culture, and downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFNα-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.
Subcellular Location
Virion. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein. Secreted. Host cytoplasm. Note=The cell surface expressed protein can undergo endocytosis. The protein is secreted in association with membranous structures.

Q&A

What is the basic structure of SARS-CoV-2 ORF3a protein and how does it compare to SARS-CoV-1 ORF3a?

ORF3a is the largest accessory protein encoded by SARS-CoV-2, consisting of 274 amino acid residues with a molecular weight of approximately 31 kDa. The protein contains an N-terminal domain, a transmembrane (TM) domain, and a C-terminal domain . Structurally, both SARS-CoV-1 and SARS-CoV-2 ORF3a proteins share significant homology, but cryo-EM structures reveal important differences, particularly in SARS-CoV-2 ORF3a's unstructured loop region that facilitates binding with VPS39, a HOPS complex tethering protein involved in late endosome and autophagosome fusion with lysosomes .

When examined by cryo-EM, both SARS-CoV-1 and SARS-CoV-2 ORF3a proteins display a narrow constriction and a positively charged aqueous vestibule, structural features that do not favor cation permeation .

Does ORF3a function as an ion channel (viroporin) as initially reported?

Contrary to earlier reports that annotated ORF3a as a viroporin, recent research demonstrates that neither SARS-CoV-2 nor SARS-CoV-1 ORF3a form functional ion conducting pores. The previously measured conductances appear to be common contaminants in overexpression studies and high-level protein reconstitution experiments .

What cellular compartments does ORF3a localize to during infection?

ORF3a colocalizes with markers of multiple cellular compartments, including:

  • Plasma membrane

  • Endocytic pathway components

  • Golgi apparatus

  • Late endosomal structures (marked by Rab7)

Upon SARS-CoV-2 ORF3a overexpression, researchers observe enrichment of the late endosomal marker Rab7 and co-immunoprecipitation with VPS39. In contrast, SARS-CoV-1 ORF3a does not cause the same cellular phenotype and does not interact with VPS39 .

Through various imaging techniques, researchers have found that ORF3a-expressing cells show LC3 puncta (autophagosome markers) that largely colocalize with RFP-RAB7-labeled late endosomes, but with reduced colocalization with lysosomal markers like LAMP2A. This suggests that autophagosomes in ORF3a-expressing cells can fuse with late endosomes but fail to properly fuse with lysosomes .

How does ORF3a contribute to inflammasome activation and cytokine production?

ORF3a is a potent activator of the NLRP3 inflammasome through a dual-signal mechanism:

Signal 1: ORF3a promotes pro-IL-1β gene transcription through NF-κB activation, which is mediated by TNF receptor-associated factor 3 (TRAF3)-dependent ubiquitination and processing of p105 .

Signal 2: ORF3a associates with TRAF3 and apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC) to induce K63-linked polyubiquitination of ASC, leading to NLRP3 inflammasome activation .

The molecular mechanism involves:

  • ORF3a interaction with TRAF3 and ASC

  • Colocalization with these proteins in discrete punctate structures in the cytoplasm

  • Facilitation of ASC speck formation

  • Enhancement of TRAF3-dependent K63-linked ubiquitination of ASC, which is more pronounced in SARS-CoV-infected cells or when ORF3a is expressed

This dual-signal activation contributes to the cytokine storm observed in severe COVID-19 cases.

What is the role of ORF3a in interferon signaling inhibition?

ORF3a significantly suppresses the interferon (IFN) signaling pathway by:

  • Upregulating SOCS1 (Suppressor of Cytokine Signaling 1) levels, which:

    • Dampens STAT1 activation

    • Mediates JAK2 ubiquitin-proteasomal degradation

  • Inhibiting IFN-activated Janus kinase (JAK)/signal transducer and activator of transcription (STAT) signaling pathway

The middle region of ORF3a (amino acids 70-130), located in the transmembrane domain, is particularly associated with the ORF3a-induced SOCS1 elevation. This finding suggests that the transmembrane domain of ORF3a plays a crucial role in viral evasion of interferon signaling .

These mechanisms contribute to SARS-CoV-2's ability to effectively evade host innate immunity by both antagonizing IFN production and inhibiting IFN signaling.

How does ORF3a affect autophagy in infected cells?

ORF3a inhibits autophagy at a stage prior to the formation of acidified degradative autolysosomes. The specific effects include:

  • Accumulation of yellow LC3 puncta (using RFP-GFP-LC3 assay) in ORF3a-expressing cells, indicating a block in autophagosome maturation

  • Reduced colocalization of LC3 puncta with late endosomal/lysosomal marker LAMP1, suggesting impaired fusion of autophagosomes with lysosomes

  • Enhanced colocalization of LC3 with RAB7-labeled late endosomes, indicating that autophagosomes can fuse with late endosomes but not with lysosomes

  • Accumulation of autophagosomes and amphisomes (fusion products of autophagosomes and endosomes) as observed by transmission electron microscopy, with autolysosomes being rarely detected

These findings indicate that ORF3a blocks HOPS complex-mediated fusion of autophagosomes and endosomes with lysosomes, potentially as a mechanism to evade lysosomal degradation of viral components.

What are the most common mutations in SARS-CoV-2 ORF3a and how might they affect function?

Analysis of SARS-CoV-2 genomes has revealed numerous non-synonymous mutations in the ORF3a protein. Some of the most prevalent mutations include:

MutationFrequency in Analyzed GenomesPROVEAN ScorePredicted Effect
Q57H485 (highest frequency)−3.286Deleterious
G251V270 (second highest)−8.581Deleterious
G196V45−6.581Deleterious
A99V23−1.962Neutral
H93Y14−3.943Deleterious
Y189C11−7.581Deleterious

The Q57H and G251V mutations appear in 9.71% and 9.71% of analyzed genomes respectively, making them the most widespread mutations in ORF3a .

Many of these mutations occur in functional domains that affect:

  • NF-κB activation

  • NLRP3 inflammasome activation

  • Protein aggregation in the Golgi apparatus

  • Dimerization and tetramerization of ORF3a

Mutations in domain-III may alter NF-κB activation and NLRP3 inflammasome function, while mutations in domain-V have been linked to aggregation of the ORF3a protein in the Golgi apparatus .

How should researchers conduct mutation analysis of ORF3a to predict functional impacts?

A comprehensive mutation analysis of ORF3a should include:

  • Genome sequence analysis: Collect complete genome sequences from databases such as NCBI and identify non-synonymous mutations in the ORF3a region .

  • Mutation effect prediction: Use computational tools like PROVEAN to predict whether mutations are deleterious or neutral based on sequence conservation and the physicochemical properties of amino acid substitutions .

  • Structural mapping: Map mutations onto available structural models of ORF3a to determine if they occur in functional domains or interfaces important for:

    • Dimerization/oligomerization

    • Protein-protein interactions

    • Transmembrane regions

    • Cytoplasmic domains

  • Timeline analysis: Study consecutive phenomena of mutations based on the timeline of detection to identify evolutionary patterns and potential adaptive changes .

  • Functional domain consideration: Pay special attention to mutations in regions known to be involved in:

    • Hydrophobic, polar, and electrostatic interactions mediating dimerization and tetramerization (positions 230, W131C, R134L, T151I, N152S, and D155Y)

    • NF-κB activation (domain-III)

    • Protein aggregation in Golgi (domain-V)

What is the ORF3a-E fusion subgenomic RNA discovered in SARS-CoV-2?

A novel subgenomic RNA (sgRNA) linking ORF3a with E protein has been identified in SARS-CoV-2. This fusion RNA, named ORF3a-E-sgRNA, has the following structure:

5' UTR (75 bp (ACGAAC) + variable RNA fragment) - ORF3a - ORF - medi-E - ORF - 3' UTR

The fusion RNA was confirmed through 5'-RACE, which validated its complete structure without extraneous sequences at the 5' end. To accurately detect this molecule, researchers designed a 3' fluorescence-labeled probe targeting segments of ORF3a-E-sgRNA, confirming its specificity and sensitivity .

When synthesized ORF3a-E-sgmRNA was capped, polyadenylated, and transfected into 293T cells, fluorescence probing and FLIM-FRET measurements revealed a decrease in fluorescence lifetime by approximately 0.2 ns upon addition of the 3a linker E, indicating potential functional significance of this fusion RNA .

This discovery adds complexity to our understanding of SARS-CoV-2 gene expression and may have implications for viral protein production and pathogenesis.

What are the optimal expression systems for recombinant ORF3a production?

Several expression systems have been successfully used for recombinant ORF3a production:

  • Mammalian expression systems:

    • Transient expression in HEK293T cells using pcDNA3.1 vectors with C-terminal tags (SNAP, HALO, or GFP) for imaging or Twin-Strep tags for affinity purification

    • Tet-inducible expression using modified Piggyback vectors (XLone) in HEK293T or A549 cells, with selection using blasticidin-HCl

    • BacMam system using modified pEZT-BM vectors

  • Xenopus oocytes:

    • In vitro transcription of cRNA from linearized pcDNA3.1 templates containing ORF3a with C-terminal tags

For stable cell line generation, researchers have successfully used:

  • Lipofectamine 2000 for HEK293T cells

  • Lipofectamine 3000 for A549 cells

  • Co-transfection with hyperactive piggyBac transposase for genome integration

Selection of high-expressing cell populations can be achieved through:

  • Antibiotic selection (10-30 μg/mL of blasticidin-HCl)

  • Flow cytometry sorting based on fluorescence intensity of tagged proteins

What techniques are most effective for analyzing ORF3a's effects on autophagy?

Several complementary techniques have proven effective for analyzing ORF3a's effects on autophagy:

  • RFP-GFP-LC3 dual fluorescence assay:

    • Relies on GFP quenching in acidified compartments

    • Yellow puncta (positive for both GFP and RFP) represent isolation membranes, autophagosomes, or un-acidified amphisomes

    • Red-only puncta represent acidified amphisomes or autolysosomes

    • Allows tracking of autophagosome maturation and acidification

  • Colocalization analysis with compartment markers:

    • Immunofluorescence with anti-LAMP1 for late endosomes/lysosomes

    • RFP-RAB7 for late endosomes

    • Anti-LAMP2A for lysosomes

    • Quantitative analysis of colocalization percentages

  • Inside-outside assay (MIL and MPL probe):

    • MIL+MPL− puncta represent isolation membranes

    • MIL+MPL+ puncta represent nascent autophagosomes

    • MIL−MPL+ puncta represent mature autophagosomes, amphisomes, and autolysosomes

    • Provides detailed staging of autophagic structures

  • Transmission electron microscopy (TEM):

    • Direct visualization of autophagic structures

    • Allows differentiation between autophagosomes, amphisomes, and autolysosomes

    • Provides ultrastructural details not available with fluorescence techniques

How can researchers effectively study ORF3a's interactions with host proteins?

Multiple techniques have been used to study ORF3a's interactions with host proteins:

  • Co-immunoprecipitation (Co-IP):

    • Effective for detecting interactions with host factors like TRAF3, ASC, and VPS39

    • Can be performed with various tags (e.g., Twin-Strep) for affinity purification

  • Fluorescence colocalization:

    • Using tagged versions of ORF3a (with SNAP, HALO, or GFP tags)

    • Counterstaining for host proteins of interest

    • Confocal microscopy for high-resolution imaging of interaction sites

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to ORF3a in cellular compartments

  • Functional assays:

    • Luciferase reporter assays to detect ISRE activation for studying effects on IFN signaling

    • RT-qPCR and immunoblotting to evaluate expression of IFN-responsive genes

    • Measurement of ASC speck formation for inflammasome activation

  • Ubiquitination assays:

    • For detecting TRAF3-dependent ubiquitination of targets like ASC and p105

    • Western blotting with ubiquitin-specific antibodies

For studying the specific regions of ORF3a responsible for protein interactions, researchers can use:

  • Truncation mutants to map interaction domains

  • Site-directed mutagenesis of key residues

  • Domain swapping between SARS-CoV-1 and SARS-CoV-2 ORF3a to identify divergent interaction capabilities

What are the key functional differences between SARS-CoV-1 and SARS-CoV-2 ORF3a proteins?

Despite their structural similarities, SARS-CoV-1 and SARS-CoV-2 ORF3a proteins exhibit several important functional differences:

  • Interaction with host trafficking machinery:

    • SARS-CoV-2 ORF3a interacts with VPS39, a HOPS complex tethering protein involved in late endosome and autophagosome fusion with lysosomes

    • SARS-CoV-1 ORF3a does not interact with VPS39 and does not cause the same cellular phenotype

  • Structural differences:

    • SARS-CoV-2 ORF3a contains a divergent, unstructured loop that facilitates its binding with VPS39

    • This additional loop enhances SARS-CoV-2 ORF3a's ability to co-opt host cellular trafficking mechanisms for viral exit or host immune evasion

  • Relationship with spike protein:

    • SARS-CoV-1 ORF3a has been shown to interact with the spike protein through interchain disulfide bonds

    • There is a tendency for co-mutation between the ORF3a protein and the spike protein in SARS-CoV-1 isolates, suggesting functional correlation

  • Immune response modulation:

    • While both proteins affect immune signaling, they may differ in the specific mechanisms and efficiency of interferon antagonism

These differences may contribute to the distinct pathogenicity profiles of SARS-CoV-1 and SARS-CoV-2 and could inform the development of targeted therapeutics.

How should researchers design experiments to compare SARS-CoV-1 and SARS-CoV-2 ORF3a functions?

To effectively compare SARS-CoV-1 and SARS-CoV-2 ORF3a functions, researchers should consider the following experimental approaches:

  • Parallel expression systems:

    • Use identical expression vectors, tags, and cell lines for both proteins

    • Standardize expression levels to ensure comparable protein amounts

    • Consider using codon-optimized sequences for optimal expression

  • Domain swapping experiments:

    • Create chimeric proteins exchanging specific domains between SARS-CoV-1 and SARS-CoV-2 ORF3a

    • Focus on the unstructured loop region that differs between the two proteins

    • Assess whether domain swapping confers gain or loss of specific functions

  • Comparative interactome analysis:

    • Perform parallel immunoprecipitation followed by mass spectrometry to identify differential protein interactions

    • Focus on host factors involved in vesicular trafficking, immune signaling, and autophagy

    • Validate key interactions using reciprocal co-immunoprecipitation

  • Functional assays:

    • Compare effects on autophagy using RFP-GFP-LC3 assays and ultrastructural analysis

    • Measure inflammasome activation through IL-1β secretion and ASC speck formation

    • Assess interferon antagonism using reporter assays and measurement of ISG expression

    • Examine effects on cellular trafficking using compartment-specific markers

  • Structural analysis:

    • Compare cryo-EM structures focusing on regions implicated in protein-protein interactions

    • Analyze differential post-translational modifications

    • Examine oligomerization properties in cellular and in vitro contexts

What makes ORF3a a potential drug target for coronavirus infections?

Several characteristics make ORF3a an attractive drug target for coronavirus infections:

  • Essential roles in viral pathogenesis:

    • Involvement in virulence, infectivity, and virus release mechanisms

    • Contribution to inflammation through NLRP3 inflammasome activation

  • Immune evasion functions:

    • Inhibition of interferon signaling pathways

    • Blockade of autophagy, an important antiviral mechanism

  • Accessibility:

    • Localization to multiple cellular compartments including plasma membrane

    • Presence of extracellular epitopes that could be targeted by antibodies

  • Antigenic properties:

    • Sera from SARS patients show significant positive reactions with synthesized peptides derived from the 3a protein

    • Potential use as a clinical marker

  • Unique structure distinct from human proteins:

    • Distinct structural features that could be targeted with small molecules

    • Less likely to cross-react with human proteins

Additionally, as an accessory protein not shared with other common coronaviruses, targeting ORF3a might allow for specific inhibition of SARS-CoV-1 and SARS-CoV-2 without affecting other coronaviruses, potentially reducing side effects of antiviral treatments.

What experimental approaches should be used to identify inhibitors of ORF3a?

A comprehensive approach to identifying ORF3a inhibitors should include:

  • Structure-based drug design:

    • Utilize available cryo-EM structures of ORF3a

    • Identify potential binding pockets, particularly in functional domains

    • Perform in silico screening of compound libraries against these target sites

  • High-throughput functional screens:

    • Develop cell-based assays measuring ORF3a-dependent phenotypes:

      • NLRP3 inflammasome activation (IL-1β secretion)

      • NF-κB activation (reporter assays)

      • Autophagy inhibition (LC3 puncta formation)

      • Interferon signaling blockade (ISRE reporter assays)

    • Screen compound libraries using these readouts

  • Protein-protein interaction disruptors:

    • Target key interactions between ORF3a and host factors (TRAF3, ASC, VPS39)

    • Use fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays to screen for compounds that disrupt these interactions

  • Antibody development:

    • Generate monoclonal antibodies against extracellular epitopes of ORF3a

    • Test their ability to neutralize ORF3a functions in cell culture models

    • Evaluate lead candidates in animal models

  • Peptide-based inhibitors:

    • Design peptides mimicking interaction interfaces between ORF3a and host factors

    • Optimize for stability, cell penetration, and target binding

    • Test in cellular infection models

Each approach should include rigorous validation steps, including dose-response relationships, specificity testing, and assessment of effects on viral replication in relevant cell culture systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.