Recombinant Human SARS coronavirus Protein 7a (7a)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Virus-Host Interactions

ORF7a modulates host cellular processes to facilitate viral replication and immune evasion:

FunctionMechanismHost ImpactReferences
Apoptosis InductionBinds anti-apoptotic Bcl-2 family proteins (Bcl-xL, Bcl-2, Mcl-1), disrupting their survival signaling.Caspase-3 activation, mitochondrial membrane permeabilization.
Immune EvasionAntagonizes IFN-I signaling via STAT2 phosphorylation inhibition.Suppresses interferon-stimulated gene (ISG) production.
Inflammation ActivationActivates NF-κB pathway via TAK1 kinase, inducing proinflammatory cytokines (IL-8, IP-10).Tissue damage, exacerbation of lung injury.
Viral Assembly SupportInteracts with viral M and E proteins, potentially aiding virion formation.Enhances structural protein organization in ER-Golgi compartments.

Host Protein Interactions

ORF7a interacts with diverse host proteins to perturb cellular homeostasis:

Host ProteinInteraction SiteFunctional OutcomeReferences
Ap4A-hydrolaseCytoplasmic bindingInhibits enzyme activity, elevating Ap4A levels → Caspase activation → Apoptosis.
BST-2 (Tetherin)Ectodomain bindingBlocks BST-2-mediated viral tethering, promoting virion release.
Small glutamine-rich tetratricopeptide repeat-containing protein (SGT)Transmembrane domainPotential role in viral particle release, analogous to HIV-1 Vpu.

Pathogenic Implications

ORF7a contributes to SARS-CoV pathogenesis through:

  1. Inflammatory Dysregulation: NF-κB activation and chemokine release exacerbate lung inflammation .

  2. Immune Suppression: IFN-I antagonism limits antiviral responses, promoting viral replication .

  3. Cell Cycle Arrest: Blocks G0/G1 progression via Rb protein dephosphorylation, creating a replicative niche .

Recombinant ORF7a in Research and Therapeutics

Recombinant ORF7a is employed in:

  • Binding Assays: Fc-chimera tagged versions (e.g., ORF7a-Fc) enable studies on BST-2 interaction .

  • Therapeutic Targeting: Inhibitors of ORF7a-BST-2 binding are proposed to restrict viral spread .

  • Structural Studies: Crystallography of the luminal domain informs drug design targeting viral-host interfaces .

Controversies and Future Directions

  • Overexpression vs. Infection Models: While overexpressed ORF7a induces apoptosis, its role in infected cells remains debated. Some studies show no significant impact on apoptosis in vivo .

  • Species-Specific Functions: SARS-CoV-2 ORF7a shares conserved functions (e.g., IFN antagonism) but differs in sequence from SARS-CoV ORF7a, suggesting divergent pathogenic mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. For shipments requiring dry ice, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We will strive to incorporate the specified tag type if provided. Please inform us of your desired tag for preferential development.
Synonyms
7a; ORF7a protein; Accessory protein 7a; Protein U122; Protein X4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-122
Protein Length
Full Length of Mature Protein
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Target Names
7a
Target Protein Sequence
ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
Uniprot No.

Target Background

Function
SARS coronavirus Protein 7a (7a) acts as an antagonist of host tetherin (BST2), effectively disrupting its antiviral activity. This disruption is achieved through binding to BST2, interfering with its glycosylation process. Protein 7a may also suppress small interfering RNA (siRNA) and bind to host ITGAL, potentially playing a role in leukocyte attachment or modulation.
Gene References Into Functions
  1. 7a accessory protein has been shown to suppress both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA. PMID: 20631126
  2. Research indicates that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17). PMID: 20144233
  3. Overexpression of 7a induces apoptosis through a caspase-dependent pathway in cell lines derived from various organs, including lung, kidney, and liver. PMID: 15564512
  4. Protein 7a expression has been associated with blockage of cell cycle progression at the G0/G1 phase in HEK 293 cells, COS-7, and Vero cells, potentially through cyclin D3 and rb protein pathways. PMID: 16303160
  5. Analysis of SARS-CoV accessory proteins 7a and 7b has been conducted. PMID: 17037516
  6. Severe acute respiratory syndrome coronavirus 7a protein induction of apoptosis is dependent on its interaction with the Bcl-XL protein. PMID: 17428862

Show More

Hide All

Database Links

KEGG: vg:1489674

Subcellular Location
Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is the structural composition of the SARS-CoV Protein 7a?

SARS-CoV Protein 7a is a 122 amino acid type I transmembrane protein with a distinct structural organization. It contains an N-terminal signal peptide, a luminal domain, a transmembrane domain, and a short C-terminal cytoplasmic tail that functions as an endoplasmic reticulum export signal . Crystallographic studies of amino acids 16-80 have revealed that the luminal domain adopts a compact immunoglobulin-like β sandwich fold. This fold is present in many different proteins, including cell surface receptors, transcription factors, and enzymes, but is not specifically indicative of 7a protein's function . The protein has no significant sequence homology with any other known proteins .

The recombinant form typically used in laboratory settings has the following specifications:

ComponentDescription
N-terminusSARS-CoV-2 ORF7a (Glu16-Leu96) Accession # YP_009724395.1
LinkerIEGRMD
C-terminusHuman IgG 1 (Pro100-Lys330)

This structural organization provides important context for understanding the protein's cellular localization and interactions with host factors.

Where is Protein 7a localized in infected cells and what is its expression pattern?

Protein 7a is expressed and retained intracellularly in SARS-CoV-infected cells, and has been primarily localized to the Golgi apparatus . This localization has been confirmed through various methodologies including immunofluorescence microscopy. The protein has been demonstrated to be expressed in SARS-CoV-infected tissue culture cells and has also been detected in lung tissue obtained from SARS-CoV patients .

The expression pattern follows the viral replication cycle, with the protein accumulating as infection progresses. Importantly, there have been some discrepancies in the literature regarding the precise subcellular localization of the protein, but the preponderance of evidence points to the Golgi as the primary site of localization . This localization is consistent with its role in modulating host cell functions and potentially interacting with cellular trafficking machinery.

How does Protein 7a contribute to viral pathogenesis despite being dispensable for replication?

Although Protein 7a is not essential for viral replication (recombinant mutant SARS-CoV lacking the 7a gene remains viable in cell culture and mouse models), it appears to significantly contribute to pathogenesis through multiple mechanisms :

  • Modulation of host signaling pathways: Protein 7a activates p38 MAPK, NF-κB, and JNK signaling pathways, which are involved in inflammatory responses .

  • Apoptosis induction: The protein induces apoptosis via the caspase-dependent pathway through interaction with Bcl-XL and other pro-survival proteins (Bcl-2, Bcl-w, Mcl-1, and A1) .

  • Inhibition of cellular translation: Protein 7a inhibits cellular protein synthesis, which may contribute to cell death and immune evasion .

  • Cell cycle disruption: The protein can block cell cycle progression at the G0/G1 phase via the cyclin D3/pRb pathway .

  • Interference with host defense mechanisms: Protein 7a binds and prevents glycosylation of host cell protein bone marrow stromal antigen 2 (BST-2), inhibiting its ability to block the release of SARS-CoV virions .

These multiple functions suggest that while Protein 7a is not required for basic viral replication, it plays important roles in optimizing the cellular environment for viral propagation and in countering host defense mechanisms.

What are the critical host protein interactions of Protein 7a and their functional significance?

Protein 7a engages in several important interactions with host proteins that appear to be critical for its various biological functions:

  • Human Ap4A-hydrolase interaction: Protein 7a interacts with asymmetrical diadenosine tetraphosphate hydrolase (Ap4A-hydrolase), an enzyme involved in metabolizing the "allarmone" nucleotide Ap4A . This interaction may affect regulation of cell proliferation, DNA replication, RNA processing, apoptosis, and DNA repair processes typically influenced by Ap4A levels. The interaction was confirmed using both yeast two-hybrid screening and co-immunoprecipitation from cultured human cells .

  • Anti-apoptotic protein interactions: Protein 7a interacts with Bcl-XL and other pro-survival proteins (Bcl-2, Bcl-w, Mcl-1, and A1). These interactions antagonize the anti-apoptotic function of these proteins, thereby promoting apoptosis in infected cells .

  • BST-2 interaction: The protein binds to bone marrow stromal antigen 2 (BST-2) and prevents its glycosylation. This inhibits BST-2's normal function of blocking virion release, thereby facilitating viral particle release from infected cells .

  • Interaction with 3a protein: 7a protein co-immunoprecipitates with another SARS-CoV protein, 3a (also known as ORF 3, ORF 3a, X1, and U274), suggesting these viral proteins may function coordinately during infection .

  • hSGT interaction: Protein 7a interacts with human small glutamine-rich tetricopeptide repeat containing protein (hSGT), although the biological significance of this interaction requires further elucidation .

These protein-protein interactions form a network through which Protein 7a exerts its effects on cellular processes and contributes to viral pathogenesis despite being dispensable for basic viral replication.

How does Protein 7a activate p38 MAPK and what are the downstream consequences?

Protein 7a activates p38 mitogen-activated protein kinase (MAPK), but not c-Jun N-terminal protein kinase/stress-activated protein kinase (JNK/SAPK) as shown by Western blot analysis using phosphospecific antibodies . This selective activation is significant for understanding the protein's cellular effects.

The mechanism by which Protein 7a activates p38 MAPK appears to be linked to its ability to inhibit cellular translation. The inhibition of translation induces cellular stress, which is a known activator of stress-responsive MAPKs like p38 . This creates a potential cascade:

  • Protein 7a inhibits cellular translation

  • Translation inhibition triggers cellular stress responses

  • Stress response activates p38 MAPK signaling

  • Activated p38 MAPK leads to:

    • Increased inflammatory cytokine production

    • Cell cycle arrest

    • Induction of apoptotic pathways

The activation of p38 MAPK by Protein 7a is particularly significant because this signaling pathway is also activated in SARS-CoV-infected cells , suggesting that Protein 7a may be one of the viral factors responsible for this aspect of infection. The downstream consequences of p38 MAPK activation include enhanced production of inflammatory cytokines and chemokines, which may contribute to the inflammatory pathology characteristic of severe SARS.

What is the relationship between Protein 7a's inhibition of translation and induction of apoptosis?

The relationship between Protein 7a's ability to inhibit cellular translation and its induction of apoptosis appears to be mechanistically linked. Research has demonstrated that:

  • Protein 7a inhibits expression of luciferase from an mRNA construct specifically measuring translation, while inhibitors of transcription and nucleocytoplasmic transport did not show similar effects .

  • The inhibition of cellular protein synthesis is a known cellular stress that can trigger apoptotic pathways.

  • Protein 7a activates p38 MAPK, which is a stress-responsive kinase implicated in apoptosis induction .

  • Several proapoptotic viral proteins with the ability to inhibit cellular gene expression have been previously identified, suggesting this may be a common mechanism through which viral proteins induce cell death .

The data indicate that Protein 7a's induction of apoptosis may follow this sequence:

  • Inhibition of cellular translation by Protein 7a

  • Translational inhibition triggers cellular stress responses

  • Stress responses activate p38 MAPK

  • p38 MAPK activation, combined with Protein 7a's interactions with anti-apoptotic proteins like Bcl-XL, leads to the induction of apoptosis

This mechanism helps explain how Protein 7a contributes to the cytopathic effects observed in SARS-CoV infection and may represent a potential target for therapeutic intervention.

What are the optimal methods for expressing and purifying recombinant Protein 7a?

For researchers working with recombinant Protein 7a, several methodological considerations are critical:

Expression Systems and Constructs:

  • Bacterial expression systems can be used for domains lacking post-translational modifications

  • Mammalian expression systems (such as HEK293T cells) are optimal for full-length protein requiring correct folding and modifications

  • Common fusion tags include Fc chimeras, V5-His tags, and GFP/fluorescent protein fusions

Purification Approach:
For carrier-free recombinant SARS-CoV-2 ORF7a Fc Chimera Protein preparation:

  • Express the protein with appropriate tags (e.g., Fc tag)

  • Purify using affinity chromatography

  • Filter through a 0.2 μm filter

  • Formulate in appropriate buffer (typically Tris, NaCl, TCEP, and Glycerol)

Storage and Stability Considerations:

  • Ship with polar packs

  • Upon receipt, store immediately at recommended temperature

  • Use a manual defrost freezer

  • Avoid repeated freeze-thaw cycles

Carrier Protein Considerations:
When working with recombinant Protein 7a, researchers should consider whether to use carrier-free preparations or those containing carrier proteins like BSA:

  • Carrier-free versions (without BSA) are recommended for applications where BSA might interfere

  • BSA-containing preparations generally provide enhanced protein stability, increased shelf-life, and allow storage at more dilute concentrations

This methodological information is particularly important for ensuring experimental reproducibility and optimal protein activity in functional studies.

How can researchers effectively study Protein 7a interactions with host proteins?

Several complementary methodologies have proven effective for studying Protein 7a interactions with host proteins:

Yeast Two-Hybrid Screening:

  • Used successfully to identify the interaction between Protein 7a and Ap4A-hydrolase

  • Allows for unbiased screening of potential interacting partners

  • Requires confirmation with additional methods due to potential false positives

Co-immunoprecipitation (Co-IP):

  • Essential for confirming interactions in mammalian cell systems

  • Typically performed using tagged versions of both Protein 7a (e.g., V5-His tagged) and the potential interacting protein (e.g., HA tagged)

  • Has successfully confirmed interactions with Ap4A-hydrolase, 3a protein, and others

Confocal Microscopy for Co-localization:

  • Human tissue culture cells transiently expressing tagged versions of Protein 7a and potential interacting proteins (e.g., EGFP and Ds-Red2 tags respectively)

  • Allows visualization of co-localization in the cytoplasm or specific cellular compartments

  • Provides spatial context for protein interactions

Functional Assays:

  • Critical for determining the biological significance of identified interactions

  • For example, enzyme activity assays to determine if Protein 7a affects the enzymatic activity of interacting proteins like Ap4A-hydrolase

  • Signal transduction assays (e.g., luciferase reporters) to measure the effect on downstream pathways

When designing experiments to study these interactions, researchers should consider controls for specificity, potential artifacts from overexpression, and validation across multiple experimental systems.

What experimental approaches are most effective for analyzing the role of Protein 7a in apoptosis induction?

Researchers investigating Protein 7a's role in apoptosis should consider multiple complementary experimental approaches:

Cell-Based Assays:

  • Morphological analysis:

    • Transfect cells with plasmids expressing Protein 7a (or fusion constructs like 7a-GFP)

    • Use appropriate controls (e.g., GFP alone)

    • Assess apoptotic morphological changes using microscopy

  • Biochemical markers:

    • Measure activation of caspases (particularly caspase-3, -8, and -9)

    • Assess cytochrome c release from mitochondria

    • Analyze PARP cleavage by Western blotting

    • Quantify phosphatidylserine externalization using Annexin V staining

    • Measure mitochondrial membrane potential changes

Molecular Interaction Studies:

  • Analysis of interaction with Bcl-XL and other anti-apoptotic proteins:

    • Co-immunoprecipitation

    • Pull-down assays

    • Fluorescence resonance energy transfer (FRET)

Signaling Pathway Analysis:

  • p38 MAPK activation:

    • Western blot with phosphospecific antibodies

    • Selective inhibitors of p38 MAPK to determine causality in apoptosis induction

    • Genetic approaches (dominant negative constructs or siRNA)

  • Translation inhibition:

    • Luciferase reporter assays specific for translation

    • Metabolic labeling to measure global protein synthesis rates

    • Polysome profiling

These methodological approaches provide complementary data that can establish both the fact of apoptosis induction by Protein 7a and elucidate the mechanisms through which this occurs, offering potential therapeutic insights.

How should researchers interpret contradictory data on Protein 7a subcellular localization?

The literature contains some discrepancies regarding the subcellular localization of Protein 7a. When encountering contradictory data, researchers should apply a systematic approach to interpretation:

Analytical Framework for Resolving Localization Discrepancies:

  • Methodological considerations:

    • Cell types used (primary cells vs. cell lines)

    • Expression methods (transient transfection vs. viral infection)

    • Detection approaches (antibodies, tags, fixation methods)

    • Resolution of imaging techniques employed

  • Protein construct considerations:

    • Full-length vs. truncated constructs

    • Native vs. tagged protein (tag size and position can affect localization)

    • Expression levels (overexpression artifacts)

  • Temporal dynamics:

    • Time points post-infection or post-transfection

    • Cell cycle stage

The predominant evidence indicates that Protein 7a is primarily localized to the Golgi apparatus in infected cells , but this localization may be dynamic or represent one stage in a trafficking pathway. When designing experiments to resolve localization questions, researchers should employ:

  • Multiple detection methods

  • Time-course analyses

  • Co-localization with established organelle markers

  • Both transfection and infection models

  • Live-cell imaging where possible

This comprehensive approach will help develop a more complete understanding of Protein 7a's subcellular distribution and trafficking.

What are the important control experiments when studying Protein 7a's effects on cellular pathways?

When investigating Protein 7a's effects on cellular pathways such as apoptosis, translation inhibition, or signaling activation, several critical controls should be included:

Essential Controls for Protein 7a Research:

  • Expression controls:

    • Empty vector controls

    • Irrelevant protein expression (e.g., GFP alone)

    • Mutated versions of Protein 7a (e.g., targeting key domains)

    • Dose-dependency analysis to account for expression level effects

  • Pathway-specific controls:

    • For apoptosis studies: positive control inducers (e.g., staurosporine)

    • For translation inhibition: known translation inhibitors (e.g., cycloheximide)

    • For p38 MAPK activation: known pathway activators (e.g., anisomycin)

  • Specificity controls:

    • Other SARS-CoV accessory proteins

    • Homologous proteins from related viruses

    • Domain-specific mutants to map functional regions

  • Timing controls:

    • Time-course experiments to establish causality and sequence of events

    • Synchronized cell populations to control for cell-cycle effects

  • Inhibitor studies:

    • Specific inhibitors of identified pathways to establish causality

    • Genetic approaches (dominant negative constructs, siRNA) as complementary strategies

The data from studies using Protein 7a should be interpreted in the context of these controls to distinguish direct effects from secondary consequences and to establish the specificity and mechanism of the observed phenotypes.

What data integration approaches are most valuable for understanding Protein 7a's role in SARS-CoV pathogenesis?

Understanding Protein 7a's contribution to SARS-CoV pathogenesis requires integration of data from multiple experimental systems and approaches:

Data Integration Framework:

  • Multi-omics integration:

    • Transcriptomic data from Protein 7a-expressing cells

    • Proteomic analysis of interacting partners

    • Phosphoproteomic data to identify activated signaling pathways

    • Metabolomic changes associated with expression

  • Structure-function correlation:

    • Crystal structure information (e.g., immunoglobulin-like β sandwich fold)

    • Mutational analysis targeting specific domains

    • Molecular dynamics simulations to understand interaction interfaces

  • In vitro to in vivo translation:

    • Cell culture studies with both overexpression and infection models

    • Animal models comparing wild-type and 7a-deleted virus

    • Clinical correlations from patient samples

  • Temporal dynamics:

    • Early vs. late effects of expression

    • Relationship to viral replication cycle

  • Systems biology approaches:

    • Network analysis of Protein 7a interactions

    • Pathway enrichment analysis of affected processes

    • Mathematical modeling of contribution to pathogenesis

By integrating data across these dimensions, researchers can develop more comprehensive models of how Protein 7a contributes to viral pathogenesis despite being dispensable for basic replication. This integrated understanding may identify leverageable vulnerabilities for therapeutic development, such as the proposed inhibition of the interaction between ORF7a ectodomain and BST2 .

What are the most promising research directions for Protein 7a as a potential therapeutic target?

Based on current understanding of Protein 7a's functions and interactions, several promising research directions emerge:

  • Targeting the interaction with BST-2: Developing therapeutics that inhibit the interaction between the ectodomain of ORF7a and BST-2 could restore BST-2's ability to block virion release, potentially inhibiting viral spread .

  • Inhibition of p38 MAPK activation: Since Protein 7a activates p38 MAPK, which contributes to inflammatory responses and apoptosis, modulating this pathway could potentially reduce pathological inflammatory responses in infected individuals .

  • Blocking interactions with anti-apoptotic proteins: Disrupting the interaction between Protein 7a and Bcl-XL or other anti-apoptotic proteins could potentially preserve cell viability during infection .

  • Ap4A-hydrolase pathway modulation: Understanding the functional consequences of Protein 7a's interaction with Ap4A-hydrolase could reveal novel therapeutic approaches targeting nucleotide signaling pathways .

  • Translation machinery protection: Developing strategies to mitigate Protein 7a's inhibition of cellular translation could preserve host cell function and immune responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.