Recombinant Human SAYSvFN domain-containing protein 1 (SAYSD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human SAYSvFN Domain-Containing Protein 1 (SAYSD1)

Recombinant Human SAYSvFN domain-containing protein 1 (SAYSD1) is a membrane protein that plays a crucial role in maintaining endoplasmic reticulum (ER) homeostasis by facilitating the clearance of stalled proteins during translation. SAYSD1 acts as a sensor for UFMylated ribosomes, which are modified by the ubiquitin-fold modifier 1 (UFM1) when translation stalls at the ER translocon. This process is essential for initiating translocation-associated quality control (TAQC), ensuring that improperly translated proteins are degraded to prevent ER stress and maintain cellular health.

Structure and Function of SAYSD1

SAYSD1 is characterized by its kinked transmembrane domain (TMD) with both N and C termini facing the cytosol. It contains a highly conserved SAYSvFN-containing domain (SACD), which is critical for its function in recognizing stalled ribosomes and facilitating their interaction with the Sec61 translocon . The interaction with the Sec61 translocon is crucial for the efficient clearance of stalled proteins through the TRAPP complex to lysosomes for degradation .

Domain/FeatureDescription
Kinked TMDBoth N and C termini face the cytosol .
SACD (SAYSvFN)Highly conserved domain essential for function .
Interaction with Sec61Critical for stalled protein clearance .

Role in Translocation-Associated Quality Control (TAQC)

SAYSD1's role in TAQC involves sensing UFMylated ribosomes at the site of clogged translocons. This sensing mechanism triggers the clearance of stalled proteins, preventing their accumulation in the ER and subsequent ER stress. In the absence of SAYSD1, cells exhibit increased levels of ER stress and defective protein biogenesis, as observed in studies using siRNA-mediated knockdown or CRISPR-Cas9 knockout of SAYSD1 .

ConditionEffect on ER Stress and Protein Biogenesis
SAYSD1 DepletionIncreased ER stress, defective protein biogenesis .
UFM1 DeficiencySimilar effects to SAYSD1 depletion .

Research Findings and Implications

Recent studies have highlighted the importance of SAYSD1 in maintaining ER homeostasis across different organisms. For instance, in Drosophila, disrupting UFM1- and SAYSD1-dependent TAQC leads to significant defects in collagen biogenesis and stress tolerance . Additionally, SAYSD1's interaction with stalled proteins like ER GFP_NS is UFMylation-dependent, further emphasizing its role in recognizing and clearing stalled nascent chains .

Organism/ModelPhenotype Upon SAYSD1 Disruption
DrosophilaDefective collagen deposition, reduced stress tolerance .
Mammalian CellsAccumulation of stalled proteins in the ER .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAYSD1; C6orf64; SAYSvFN domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SAYSD1
Target Protein Sequence
MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPAS ARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELE FGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPL AGR
Uniprot No.

Target Background

Database Links

HGNC: 21025

KEGG: hsa:55776

STRING: 9606.ENSP00000229903

UniGene: Hs.58382

Subcellular Location
Cytoplasmic vesicle membrane; Single-pass membrane protein.

Q&A

What is the basic structure and localization of SAYSD1?

SAYSD1 is a membrane protein predicted to contain a kinked transmembrane domain (TMD) with both N and C termini facing the cytosol. It features a short helical segment preceding the TMD, followed by a highly conserved SAYSvFN-containing domain (SACD). The protein has a molecular weight of approximately 20 kDa . Confocal microscopy studies show that SAYSD1 is primarily localized to the endoplasmic reticulum, with a fraction found in perinuclear puncta marked by the Golgi protein GM130, suggesting it may cycle between these membrane compartments .

What are the critical functional domains of SAYSD1?

SAYSD1 contains several critical functional domains that have been identified through mutational studies. These include:

  • An N-terminal segment (first 17 residues)

  • A middle helical (MH) segment

  • A highly conserved SAYSvFN-containing domain (SACD)

Deletion mutants lacking either the N-terminal 17 residues (ΔN17) or the middle helical segment (ΔMH), as well as mutants with alanine substitutions in the SAYSvFN motif (SAYSD1-7A), show impaired ability to restore normal degradation of stalled translocation substrates in SAYSD1-depleted cells . Notably, the MH segment has been shown to directly bind UFM1 in in vitro binding assays, suggesting its role as a UFM1 sensor .

How is SAYSD1 evolutionarily conserved?

SAYSD1 (also known as C6orf64) is highly conserved across metazoan species but notably absent in fungi . This evolutionary conservation pattern is similar to that observed for other components of the UFMylation pathway, suggesting a coordinated evolution of the TAQC system specifically in multicellular animals.

What are the most effective methods for detecting endogenous SAYSD1?

For detecting endogenous SAYSD1, researchers can employ several complementary approaches:

  • Western blotting using validated antibodies against SAYSD1

  • Generation of endogenously tagged SAYSD1 cell lines (such as SAYSD1::GFP) for immunoprecipitation and localization studies

  • Immunofluorescence microscopy to visualize subcellular localization

When performing subcellular fractionation, it's important to use appropriate membrane solubilization conditions, as SAYSD1 is a membrane-associated protein. For co-immunoprecipitation studies examining SAYSD1 interactions with translocon components or ribosomes, crosslinking approaches may enhance detection of transient interactions .

What are validated approaches for SAYSD1 gene manipulation?

CRISPR-Cas9 technology has been successfully employed to generate SAYSD1 knockout cell lines. The gRNA sequences designed by Feng Zhang's laboratory at the Broad Institute efficiently target the SAYSD1 gene with minimal risk of off-target Cas9 binding . When designing knockout experiments, it's recommended to order at least two gRNA constructs per gene to increase the chance of successful targeting .

For siRNA-mediated knockdown, studies have demonstrated effective SAYSD1 depletion that results in measurable phenotypes related to TAQC dysfunction, including accumulation of ER-targeted reporter proteins with ribosome-stalling sequences .

What recombinant SAYSD1 protein resources are available for in vitro studies?

Recombinant human SAYSD1 protein expressed in HEK293 cells with Myc-DYKDDDDK tag is commercially available . This protein preparation has a purity of >80% as determined by SDS-PAGE and Coomassie blue staining, making it suitable for:

  • Use as a native antigen for optimized antibody production

  • Positive controls in ELISA and other antibody assays

  • In vitro binding studies with potential interaction partners

When working with recombinant SAYSD1, proper storage is crucial; it should be kept at -80°C, thawed on ice, aliquoted to individual single-use tubes, and then re-frozen immediately. Only 2-3 freeze-thaw cycles are recommended to maintain protein integrity .

How does SAYSD1 interact with the UFMylation pathway?

SAYSD1 functions as a UFM1 sensor in the translocation-associated quality control (TAQC) system. It directly interacts with UFM1 through its middle helical (MH) segment, as demonstrated in in vitro binding assays with purified recombinant proteins . Immunoprecipitation studies have shown that SAYSD1 also associates with the UFMylation ligase UFL1 .

Importantly, SAYSD1 specifically recognizes UFMylated ribosomes during translocon clogging events. Upon treatment with translation elongation inhibitors like anisomycin that induce ribosome UFMylation, SAYSD1 shows increased association with ribosomes . This interaction is significantly reduced in UFM1 knockout cells or in cells lacking the UFMylation site on the ribosomal protein RPL26, confirming the UFMylation-dependent nature of this interaction .

What is the functional relationship between SAYSD1 and the Sec61 translocon?

SAYSD1 constitutively associates with the Sec61 translocon, as demonstrated by co-immunoprecipitation and sucrose gradient co-sedimentation with Sec61β, a key component of the ER translocon . This interaction positions SAYSD1 at the site of protein translocation across the ER membrane.

How can researchers distinguish between SAYSD1-dependent TAQC and other protein quality control pathways?

Distinguishing SAYSD1-dependent TAQC from other quality control pathways requires careful experimental design:

  • Use of specific substrates: Employ model substrates like ER GFP_K20 that contain signal sequences for ER targeting and sequences that cause ribosome stalling during translocation. Compare with control substrates lacking the stalling sequence (like ER GFP_K0) .

  • Pathway-specific inhibitors: Compare the effects of inhibitors of different degradation pathways:

    • Bafilomycin A1 (Baf A1) for lysosomal degradation

    • Proteasome inhibitors for ERAD and cytosolic degradation

  • Genetic ablation of pathway components: Perform comparative analyses in cells with:

    • SAYSD1 knockout/knockdown

    • UFM1 pathway component knockout/knockdown

    • ERAD component knockout/knockdown

    • RQC component knockout/knockdown

In SAYSD1 knockout cells, translocation-stalled proteins accumulate primarily in the ER, co-localizing with the ER marker calreticulin . This contrasts with the fate of ERAD substrates, which are retrotranslocated to the cytosol, or RQC substrates, which never enter the ER lumen.

How can researchers effectively design experimental models to study SAYSD1 function in collagen biogenesis?

Collagens have been identified as endogenous TAQC substrates, making them excellent targets for studying physiological SAYSD1 function . To design effective experimental models:

  • Cell culture systems: Use fibroblasts or other collagen-producing cells with SAYSD1 knockout or knockdown, and assess:

    • Intracellular accumulation of collagen

    • Secretion efficiency of different collagen types

    • ER stress markers in response to collagen expression

  • 3D matrix models: Examine collagen deposition and organization in:

    • Cell-derived matrices from SAYSD1-depleted cells

    • Reconstituted matrices with purified collagens from control vs. SAYSD1-depleted cells

  • Drosophila model: Utilize Drosophila, where disruption of UFM1- and SAYSD1-dependent TAQC leads to:

    • Intracellular accumulation of translocation-stalled collagens

    • Defective collagen deposition

    • Abnormal basement membranes

    • Reduced stress tolerance

When designing these experiments, it's crucial to include appropriate controls for general secretion defects and to distinguish TAQC-specific effects from general ER stress responses.

What approaches can be used to identify novel SAYSD1 substrates beyond collagens?

To identify novel SAYSD1 substrates, researchers can employ several complementary approaches:

  • Proximity labeling: Use APEX2 or BioID fused to SAYSD1 to identify proteins in close proximity during translocation stalling.

  • RNA-Seq analysis: Compare transcript levels in control vs. SAYSD1-depleted cells under conditions of ER stress to identify transcripts that might be regulated by SAYSD1-dependent mechanisms.

  • Proteomic analysis: Perform quantitative proteomics comparing:

    • Membrane fractions from wild-type vs. SAYSD1 knockout cells

    • Proteins co-immunoprecipitating with SAYSD1 under various stress conditions

    • Lysosomal contents in control vs. SAYSD1-depleted cells treated with lysosomal inhibitors

  • Candidate approach: Focus on proteins sharing characteristics with known TAQC substrates:

    • Proteins with complex signal sequences

    • Large secretory proteins prone to misfolding

    • Proteins with regions that might cause translational pausing

Cross-validation with UFM1 pathway components can help confirm true SAYSD1-dependent TAQC substrates.

How can the interaction between SAYSD1 and UFMylated ribosomes be structurally characterized?

Structural characterization of the SAYSD1-UFMylated ribosome interaction presents technical challenges but can be approached through:

  • Cryo-electron microscopy (cryo-EM): Purify complexes of SAYSD1 with UFMylated ribosomes and determine their structure by cryo-EM. This approach could reveal:

    • The binding interface between SAYSD1 and the ribosome

    • Conformational changes induced by UFMylation

    • The position of SAYSD1 relative to the translocon and nascent chain

  • Cross-linking mass spectrometry (XL-MS): Use chemical cross-linkers to capture the interaction between SAYSD1 and UFMylated ribosomes, followed by mass spectrometry to identify cross-linked peptides and map the interaction interface.

  • In vitro reconstitution: Express and purify domains of SAYSD1 (particularly the middle helical segment and SACD) along with UFMylated ribosomal proteins to characterize their interactions through:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Nuclear magnetic resonance (NMR) for smaller domains

These structural studies would complement the existing biochemical data showing that SAYSD1 binds UFMylated ribosome in a bipartite manner involving both UFM1 recognition and ribosome interaction .

What is the potential role of SAYSD1 in collagen-related disorders?

Given SAYSD1's role in collagen biogenesis, dysfunction in this pathway could potentially contribute to collagen-related disorders. In Drosophila models, disruption of UFM1- and SAYSD1-dependent TAQC leads to intracellular accumulation of translocation-stalled collagens, defective collagen deposition, and abnormal basement membranes . These phenotypes resemble aspects of certain connective tissue disorders in humans.

Research approaches to investigate SAYSD1's role in collagen-related pathologies should include:

  • Genetic association studies examining SAYSD1 variants in patient cohorts with unexplained connective tissue disorders

  • Histological examination of collagen deposition and basement membrane structure in tissues from models with SAYSD1 deficiency

  • Analysis of collagen secretion and processing in primary cells from patients with suspected TAQC defects

Understanding how SAYSD1 dysfunction affects specific collagen types could provide insights into targeted therapeutic approaches for collagen-related disorders.

How does SAYSD1 contribute to cellular stress responses?

SAYSD1 depletion causes the accumulation of translocation-stalled proteins at the ER and triggers ER stress . This suggests that SAYSD1 plays a crucial role in maintaining ER homeostasis during conditions that challenge protein translocation.

To investigate SAYSD1's contribution to stress responses, researchers should:

  • Monitor canonical unfolded protein response (UPR) markers in SAYSD1-depleted cells under normal and stress conditions

  • Compare the kinetics of stress recovery in wild-type vs. SAYSD1-deficient cells after transient stress exposure

  • Analyze stress tolerance in animal models with tissue-specific SAYSD1 depletion

  • Investigate potential compensatory mechanisms activated in chronic SAYSD1 deficiency

Interestingly, treatment with Bafilomycin A1 leads to more pronounced accumulation of non-stalling proteins (ER GFP_K0) in UFM1 and SAYSD1 knockout cells than in wild-type cells, suggesting that defects in UFM1- and SAYSD1-mediated TAQC may induce compensatory degradation mechanisms .

What are promising approaches to identify small molecule modulators of SAYSD1 function?

Developing small molecule modulators of SAYSD1 function could provide valuable research tools and potential therapeutic leads. Promising screening approaches include:

  • High-throughput screens based on TAQC reporter systems: Utilize cells expressing ER GFP_K20 reporter and screen for compounds that rescue or exacerbate the fluorescence phenotype in SAYSD1-depleted cells.

  • AlphaScreen for SAYSD1-UFM1 interaction: Develop in vitro assays using purified components to screen for molecules that modulate the direct interaction between SAYSD1's middle helical segment and UFM1.

  • Fragment-based drug discovery: Use NMR or X-ray crystallography with purified SAYSD1 domains to identify fragment hits that bind to functional surfaces.

  • In silico screening: Once structural data becomes available, perform virtual screening against the UFM1-binding pocket or the ribosome interaction surface.

When developing these assays, it's important to include counterscreens to distinguish compounds affecting general ER homeostasis from those specifically modulating SAYSD1 function.

How might single-cell approaches advance our understanding of SAYSD1 function?

Single-cell technologies offer unique opportunities to uncover cell-type-specific and context-dependent functions of SAYSD1:

  • Single-cell RNA-seq (scRNA-seq): Compare transcriptional responses to SAYSD1 depletion across different cell types, potentially revealing cell-specific TAQC substrates and compensatory mechanisms.

  • Single-cell proteomics: Analyze protein expression changes in SAYSD1-depleted cells at the single-cell level to capture heterogeneous responses that might be masked in bulk analysis.

  • Live-cell imaging: Develop fluorescent reporters to monitor SAYSD1 dynamics and TAQC activity in real-time at the single-cell level, potentially revealing oscillatory behaviors or threshold effects.

  • Spatial transcriptomics: Map the expression of SAYSD1 and potential substrate mRNAs in complex tissues to identify spatial relationships that might suggest tissue-specific functions.

These approaches could provide insights into why certain cell types might be more vulnerable to SAYSD1 dysfunction than others, potentially explaining tissue-specific manifestations of TAQC defects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.