Recombinant Human Secretory carrier-associated membrane protein 4 (SCAMP4)

Shipped with Ice Packs
In Stock

Description

Role in Membrane Trafficking

SCAMP4 facilitates vesicle-mediated secretion and endocytic recycling. Its membrane core binds phospholipids via amphiphilic helices, enabling interactions with trafficking machinery . Unlike SCAMP1, SCAMP4’s lack of NPF repeats suggests divergent regulatory mechanisms .

Senescence-Associated Secretory Phenotype (SASP)

SCAMP4 is upregulated in senescent cells and enhances the secretion of pro-inflammatory SASP factors such as:

  • IL-6, IL-8, GDF-15, CXCL1, and IL-7 .

  • Silencing SCAMP4 reduces SASP factor secretion by >50% in senescent fibroblasts .

  • Overexpression in proliferating cells increases SASP factor production, accelerating senescence .

Research Use

  • Antibody validation: Recombinant SCAMP4 fragments (e.g., aa 171–229) serve as blocking controls in Western blot (WB) and immunohistochemistry (IHC) .

  • Senescence studies: Used to model SASP regulation and screen anti-aging compounds .

Disease Associations

SCAMP4 dysregulation is linked to:

  • Neurodevelopmental disorders: Mutations correlate with brain abnormalities and dysmorphic facies .

  • Strabismus: Altered expression observed in ocular alignment defects .

  • Cancer: Promotes tumor microenvironment remodeling via SASP factor secretion .

Future Directions

Current research aims to:

  • Develop SCAMP4 inhibitors to mitigate age-related inflammation.

  • Explore its role in neurodegenerative disease progression.

  • Optimize recombinant SCAMP4 for high-throughput drug screening .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCAMP4; Secretory carrier-associated membrane protein 4; Secretory carrier membrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SCAMP4
Target Protein Sequence
MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLA WWIGGGSGTNFGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTV IQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG GSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 4 (SCAMP4) is likely involved in membrane protein trafficking.
Gene References Into Functions
  1. Studies have shown that secretory carrier membrane protein 4 (SCAMP4) levels are significantly elevated on the surface of senescent cells compared to proliferating cells. PMID: 29967290
Database Links

HGNC: 30385

OMIM: 613764

KEGG: hsa:113178

STRING: 9606.ENSP00000316007

UniGene: Hs.144980

Protein Families
SCAMP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of human SCAMP4 and how does it differ from other SCAMP family members?

Human SCAMP4 is a smaller member (~25 kDa) of the SCAMP family that lacks most of the N-terminal hydrophilic domain found in other SCAMPs (32-38 kDa). The protein retains the core membrane structure, which consists of four transmembrane spans and three amphiphilic segments that are highly conserved structural elements . This structural arrangement suggests that the membrane core alone, present in all SCAMP family members including SCAMP4, is the functional domain of these proteins . The conserved amphiphilic segments are likely to carry out interfacial activity at the cytoplasm-facing membrane interface .

Unlike other SCAMPs that contain specific motifs in their N-terminal domain (including NPF repeats, a leucine heptad repeat enriched in charged residues, and a proline-rich SH3-like and/or WW domain–binding site), SCAMP4's truncated structure provides a unique model to study the essential functional core of the SCAMP family . This structural difference may explain distinct functional properties of SCAMP4 compared to other family members.

What are the expression patterns of SCAMP4 in normal and pathological tissues?

SCAMP4 shows differential expression patterns between normal and pathological tissues. In pancreatic adenocarcinoma (PAAD), SCAMP4 expression is significantly upregulated compared to normal pancreatic tissue, as demonstrated by analyses using Gene Expression Profiling Interactive Analysis (GEPIA) datasets that assess TCGA and GTEx databases . Similar upregulation patterns are observed for SCAMPs 1-3 in PAAD, while SCAMP5 shows the opposite trend with downregulation in cancer tissue .

ROC curve analysis has shown that SCAMP4 has an AUC index of 0.567 (p<0.05) in TCGA and GTEx datasets for distinguishing between normal and cancerous pancreatic tissue . While this diagnostic value is lower compared to other SCAMPs (SCAMP1: 0.867, SCAMP2: 0.890, SCAMP3: 0.797, SCAMP5: 0.913), it still suggests potential utility of SCAMP4 as a biomarker in pancreatic cancer research . Correlation analyses also indicate that SCAMP3 and SCAMP4 expression patterns are positively correlated (R: 0.37, p < 0.05) in PAAD samples .

What experimental approaches are most effective for studying SCAMP4 trafficking and membrane dynamics?

Multiple complementary approaches should be employed to comprehensively study SCAMP4 trafficking and membrane dynamics. Based on methodologies successfully applied to other SCAMP family members, the following techniques are recommended:

  • Subcellular fractionation combined with Western blotting: This approach allows for quantitative assessment of SCAMP4 distribution across different membrane compartments. By isolating distinct cellular fractions (plasma membrane, Golgi, endosomes, etc.) followed by immunoblotting with SCAMP4-specific antibodies, researchers can determine the relative abundance of SCAMP4 in various compartments under different experimental conditions .

  • Immunofluorescence confocal microscopy: This technique enables visualization of SCAMP4 localization and potential colocalization with other proteins. Double or triple labeling with markers for specific organelles (e.g., GM130 for Golgi, EEA1 for early endosomes) can reveal SCAMP4's dynamic localization patterns . Live-cell imaging using fluorescently tagged SCAMP4 constructs can further illuminate trafficking events in real-time.

  • Membrane vesicle immunoisolation: This method involves using antibodies against SCAMP4 or compartment-specific markers to isolate vesicles containing SCAMP4, followed by proteomic analysis to identify interacting partners .

  • Limited proteolysis and topology mapping: As demonstrated with SCAMP1, limited proteolysis of isolated secretory vesicles combined with domain-specific antibody detection can provide insights into SCAMP4's membrane orientation . Additionally, expression of alkaline phosphatase gene fusions in E. coli has proven valuable for mapping transmembrane segments .

How does recombinant SCAMP4 expression impact cellular secretory pathways and what are the implications for exocytosis research?

Recombinant SCAMP4 expression likely impacts cellular secretory pathways through multiple mechanisms. Drawing from studies on other SCAMP family members, particularly SCAMP5, several implications for exocytosis research can be identified:

SCAMP proteins participate in calcium-regulated exocytosis, particularly for signal peptide-containing molecules . When investigating recombinant SCAMP4's impact on secretory pathways, researchers should focus on measuring the secretion of model cargoes (such as cytokines) under various calcium concentrations . For example, experiments with SCAMP5 demonstrated promotion of calcium-regulated secretion of signal peptide-containing cytokines like CCL5, but not IL-1β .

Recombinant SCAMP4 may interact with the SNARE (soluble N-ethylmaleimide sensitive factor attachment protein receptors) machinery, which is essential for membrane fusion during exocytosis . Co-immunoprecipitation and colocalization studies should be conducted to identify potential interactions between SCAMP4 and SNARE components under different stimulatory conditions. Research on SCAMP5 showed that it can complex with local SNARE molecules during translocation from Golgi apparatus to plasma membrane .

Calcium-triggered translocation experiments using ionophores like ionomycin can reveal whether SCAMP4, like SCAMP5, redistributes from Golgi apparatus to plasma membrane during stimulated exocytosis . Such translocation studies are critical for understanding SCAMP4's dynamic behavior during secretory events.

What are the current challenges in isolating high-purity recombinant human SCAMP4 for structural studies?

Isolating high-purity recombinant human SCAMP4 for structural studies presents several significant challenges:

  • Membrane protein solubilization: As an integral membrane protein with four transmembrane spans, SCAMP4 requires careful selection of detergents or lipid nanodiscs for solubilization while maintaining native conformation . The choice of solubilization method significantly impacts downstream purification efficiency and protein activity.

  • Expression system selection: While E. coli has been used for topology studies of SCAMP1 using alkaline phosphatase fusions , mammalian or insect expression systems may be more appropriate for full-length SCAMP4 expression to ensure proper folding and post-translational modifications. Each expression system presents distinct advantages and challenges that must be evaluated based on the specific research objectives.

  • Purification strategy optimization: Affinity tags must be strategically positioned to avoid interfering with SCAMP4's functional domains, particularly the conserved amphiphilic segments at the cytoplasm-facing membrane interface . Tag positioning at either the N- or C-terminus (both cytoplasmic) requires careful consideration of potential structural perturbations.

  • Stability during concentration and storage: The amphiphilic nature of SCAMP4's conserved segments that bind to phospholipid membranes may cause aggregation during concentration steps. Stabilizing additives and optimal buffer compositions need to be empirically determined to maintain protein solubility and conformational integrity throughout the purification process.

What expression systems and purification strategies are most effective for producing functional recombinant human SCAMP4?

Based on successful approaches with other membrane proteins and SCAMP family members, several expression systems and purification strategies should be considered:

Expression Systems:

  • Mammalian expression systems: HEK293 or CHO cells provide proper post-translational modifications and membrane insertion machinery. These systems are particularly valuable when studying SCAMP4's interaction with mammalian proteins like SNAREs and synaptotagmins .

  • Insect cell/baculovirus expression system: Offers higher yield compared to mammalian systems while maintaining proper folding and post-translational modifications. This system provides a good balance between yield and protein quality for structural studies.

  • Yeast expression systems (S. cerevisiae or P. pastoris): While not extensively documented for SCAMPs, these systems have been successful for other membrane proteins and offer cost-effective scaled production.

Purification Strategies:

  • Two-step affinity purification: Utilizing a dual-tag approach (e.g., His-tag and FLAG-tag) at opposite termini can significantly enhance purity. Since both N and C termini of SCAMP4 are cytoplasmic , both ends are accessible for tagging without disrupting membrane topology.

  • Detergent screening: Systematic evaluation of detergents (e.g., DDM, LMNG, GDN) is critical for optimal solubilization of SCAMP4 while preserving structural integrity. Circular dichroism spectroscopy can be used to assess secondary structure maintenance, as has been done for SCAMP amphiphilic peptides .

  • Size exclusion chromatography: As a final polishing step to separate monomeric SCAMP4 from aggregates and to confirm quaternary structure homogeneity.

  • Reconstitution into nanodiscs or liposomes: For functional studies, reconstitution into lipid environments that mimic native membranes may be necessary to preserve activity, particularly if studying SCAMP4's proposed interfacial activities .

What analytical techniques provide the most reliable data for assessing SCAMP4 interactions with other proteins in the secretory pathway?

Multiple complementary analytical techniques should be employed to comprehensively assess SCAMP4 interactions:

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry: This approach identifies physiologically relevant protein complexes. When studying SCAMP4, particular attention should be paid to potential interactions with SNARE machinery components and calcium sensors like synaptotagmins, which have been shown to interact with other SCAMP family members through their cytosolic C-terminal tail .

  • Proximity-based labeling techniques: BioID or APEX2 fusion constructs of SCAMP4 can identify proximal proteins in living cells, providing a more comprehensive view of the SCAMP4 interactome in its native cellular environment.

  • Förster Resonance Energy Transfer (FRET): Live-cell FRET measurements between fluorescently tagged SCAMP4 and potential binding partners can reveal dynamic interactions during trafficking events, particularly during calcium-triggered translocation along the secretory pathway .

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI): These techniques provide quantitative binding kinetics (kon, koff, KD) between purified SCAMP4 (or specific domains) and candidate interacting proteins. These methods are particularly valuable for validating direct interactions and characterizing binding affinity changes under different conditions (e.g., calcium concentration).

  • Cryo-electron microscopy: For structural characterization of SCAMP4 complexes with interacting partners, potentially revealing the molecular basis of these interactions.

How can researchers effectively design experiments to distinguish SCAMP4-specific functions from other SCAMP family members?

Designing experiments to distinguish SCAMP4-specific functions requires strategic approaches that leverage SCAMP4's unique structural features and expression patterns:

  • CRISPR-Cas9 gene editing for isoform-specific knockout: Generate cell lines with specific deletion of SCAMP4 while maintaining expression of other SCAMP family members. Complementation experiments with wild-type SCAMP4 or domain-swapped chimeras between SCAMP4 and other family members can reveal unique functional domains .

  • Isoform-specific antibodies for localization and functional studies: Develop antibodies targeting unique epitopes of SCAMP4, particularly regions that differ from other SCAMPs. The shorter N-terminal domain of SCAMP4 compared to other family members provides a potential target for specific antibody development .

  • Correlation analysis in disease models: Leverage the distinct expression patterns of SCAMP family members in disease states (e.g., differential expression in pancreatic cancer) to identify SCAMP4-specific correlations with disease parameters . For instance, while SCAMP3 and SCAMP4 expressions correlate in pancreatic adenocarcinoma (R: 0.37, p < 0.05), other SCAMP members show different correlation patterns .

  • Domain-specific mutational analysis: Target conserved versus non-conserved regions of SCAMP4 for site-directed mutagenesis. Pay particular attention to the three conserved amphiphilic segments in the membrane core, which are proposed to be critical functional elements .

  • Cargo-specific transport assays: Develop assays that measure transport of specific cargoes regulated by different SCAMP family members. For example, SCAMP5 has been shown to specifically promote calcium-regulated secretion of signal peptide-containing cytokines like CCL5 but not IL-1β . Similar cargo specificity may exist for SCAMP4.

What emerging technologies might advance our understanding of SCAMP4 function in membrane trafficking?

Several cutting-edge technologies hold promise for advancing SCAMP4 research:

  • Cryo-electron tomography: This technique allows visualization of SCAMP4 in its native membrane environment at near-atomic resolution. By capturing SCAMP4-containing vesicles at different stages of trafficking, researchers can gain unprecedented insights into structural changes during membrane fusion and fission events.

  • Super-resolution microscopy techniques: Methods such as STORM, PALM, or STED microscopy can overcome the diffraction limit of conventional microscopy, enabling visualization of SCAMP4 distribution and dynamics at nanometer resolution. These approaches are particularly valuable for studying SCAMP4's behavior at the interface between different membrane compartments.

  • Single-molecule tracking: By labeling individual SCAMP4 molecules with quantum dots or photoactivatable fluorophores, researchers can track their movement and interactions in living cells with high spatial and temporal resolution. This approach can reveal transient interactions and rare trafficking events that might be missed by ensemble measurements.

  • Optogenetic tools for acute manipulation: Development of light-sensitive SCAMP4 variants would allow precise temporal control over SCAMP4 activity or localization. These tools could help dissect the immediate consequences of SCAMP4 activation or inactivation on membrane trafficking events.

  • Artificial intelligence for image analysis: Machine learning algorithms can be trained to recognize and quantify complex patterns in SCAMP4 localization and trafficking data, potentially revealing subtle phenotypes that might be missed by conventional analysis methods.

How might our understanding of SCAMP4 inform therapeutic approaches for diseases with aberrant secretory pathways?

The role of SCAMP4 in membrane trafficking and its altered expression in disease states suggests several potential therapeutic applications:

  • Cancer therapy targeting: The upregulation of SCAMP4 in pancreatic adenocarcinoma compared to normal tissue suggests it may contribute to cancer pathophysiology . Developing inhibitors that specifically target SCAMP4 function could potentially modulate cancer cell secretion of growth factors or cytokines that promote tumor progression.

  • Neurodegenerative disease interventions: While specific information about SCAMP4 in neurodegeneration is limited in the provided search results, other SCAMP family members (particularly SCAMP5) have been implicated in neuronal function . By extension, SCAMP4 modulation might influence protein trafficking pathways that are dysregulated in neurodegenerative conditions.

  • Inflammatory disorder treatments: Given the role of SCAMP5 in regulating signal peptide-containing cytokine secretion , SCAMP4 might similarly influence inflammatory cytokine release. Targeting SCAMP4 could potentially provide a novel approach to modulating inflammatory responses in conditions like autoimmune disorders.

  • Biomarker development: The differential expression of SCAMP4 between normal and cancer tissues suggests potential utility as a biomarker . Further characterization of SCAMP4 expression patterns across different disease states could lead to the development of diagnostic or prognostic tools.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.